SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000024163 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000024163
Domain Number 1 Region: 1439-1578
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.26e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000212
Further Details:      
 
Domain Number 2 Region: 234-338
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000612
Family Calponin-homology domain, CH-domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000024163
Sequence length 1583
Comment (Rattus norvegicus)
Sequence
MVDAGGRSAAEGWRRMEAPPEGADLVPLDRYDAARAKIAANLQWICAKAYGLDNIPEDLR
DPFYIDQYEQEHIKPPVIKLLLSSELYCRVCSLILKGDQAATLQGHQSVIQALSRKGIYV
MESDDTPVTDADLSQAPIKMSGHMAMVDALMMAYTVEMISIEKVVASVKRFSTFSASKEL
PYDLEDAMVFWINKVNLKMREITEKEVKLKQQPLESPAHQKVRYRREHLSARQSPYFPLL
EDLMRDGSDGAALLAVVHYYCPEQMKLDDICLKEVPSMADSLYNIRLLREFSNEHLNKCF
YLTLEDMLYAPLVLKPNVMVFIAELFWWFENVKPDFVQPRDIQELKDAKTVLQQKSSRPP
VPISNATKRSFLGSPAAMSPADLPPSTQPLTEGSHRYHLHSEEPECLGKGASTFSPSHPL
LPLRQKQQKVSQAEEIPDQRHRSNSLTRADGQPRGAAIAWPDKKNRPVSQPTSFALHHAA
SCDVDPSSGDSISLARSISKDSLASNIIHLTPQNQPHPSAGKTNGKSLLSNVNIEDDEEE
ELVAIIRTDVSPHSPEIPRTSPQAPGLVASIRSPQRQADTLESKPDSFYLEPLMPAVLRP
AKEKQIITKEDERGEGRPRTIMAKRPSEGSQPLVRKKVTGSHGSRDLNRTFTPIPCSEFA
ASIDPTEVGPQSTEATGEGQPLALGRFDPVPQGQVADGFFLHVGRAEEDEGRWYVGSQSP
SSHDSEPWTILRQDSDSDVVDVEDAEQDFIGEDHPVVIPRYAGEEESAKLQEDMKVKEHE
DKDDASGRSSPCLSTTSQLSSMSMASGSVKMTSFAERKLQRLNSCETKSSTSSSQKTTPD
ASESCPAPLTTWRQKREQSPSRHSKDPASLLASELVQLHMQLEEKRRAIEAQKKKMEALS
ARQRLKLGKAAFLHVVKKGKADGAPQPLRPEHFTKEFTQHNGEDLDDGTCKTEGFLVKEE
QRDLSDSQDVAFVQLHKPRDPATLHDGEKHRVISAALLEDSVGEVDVNECDLSIEKLNET
ISTLQQAILKISQQQEQLLMKSPTVPTSGTKNNCQDQKVKAPVHFVEPLSPTGVPGHRKP
PRLGQGRNSRSGRPAELKVPKDRQQGCSRSKTPTPSVETLPHSRSLPPSTHPRSPLDPGG
ELPEKCLFDSYRLHDESNHRTFGLSSCKDANIVSEQMNFKEGLDTSVQEAELSSSAITGK
EHTPMEEPLRSKASLIEVDLSDLKAPDEDGEVVGHESSLELGGESDQKPGVGFFFKDEQK
AEDELAKKRAAFLLKQQRKAEEARARKQQLEAEVELKRDEARRKAEEDRLRKEEEKARRE
LIKQEYLRRKQQQALEEQGLGKPKSKPKKPRPKSVHREESCSDSGTKCSSTHNLSQTHSG
SSLSLASAATTEPESVHSGGTPSHRVESLEALPILSRNPSRSTDRDWETASAASSLASVA
EYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSILEELEKCDANHYIILFRDA
GCQFRALYCYQPDTEEIYKLTGTGPKSITKKMIDKLYKYSSDRKQFNLIPAKTMSVSVDA
LTIHNHLWQPKRPTVPKKTQTRK
Download sequence
Identical sequences XP_006233736.1.100692 10116.ENSRNOP00000024163 ENSRNOP00000060119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]