SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000025624 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000025624
Domain Number 1 Region: 142-254
Classification Level Classification E-value
Superfamily C-type lectin-like 7.76e-38
Family Link domain 0.0018
Further Details:      
 
Domain Number 2 Region: 256-339
Classification Level Classification E-value
Superfamily C-type lectin-like 7.93e-24
Family Link domain 0.002
Further Details:      
 
Domain Number 3 Region: 44-147
Classification Level Classification E-value
Superfamily Immunoglobulin 8.66e-16
Family I set domains 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000025624
Sequence length 341
Comment (Rattus norvegicus)
Sequence
MPSWIPLPAFCCLLLPWAFTVFHKTLGNPAPHPGPHYLLPPIHEVIHSRRGATATLPCVL
GTSPPSYKVRWSKVEPGELRETLILITNGLHARDYGLLGGRASLRRGHRLDASLIIKNVR
LEDEGRYRCELINGIEDESVALTLRLEGVVFPYQPSRGRYQFNYFEAKRACEEQDGRLAT
YSQLYQAWTEGLDWCNAGWLLEGSVRYPVLNARAPCGGHGRPGIRSYGPRDRSRDRYDAF
CFTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYAAWKFSGLDRCDGGWLADGS
VRFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYCYAEK
Download sequence
Identical sequences G3V8G6
XP_006232813.1.100692 XP_008759431.1.100692 XP_017446556.1.100692 NYSGRC-IgSF-ENSRNOP00000025624 ENSRNOP00000025624 ENSRNOP00000025624 10116.ENSRNOP00000025624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]