SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000026089 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000026089
Domain Number 1 Region: 534-710
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-41
Family SPRY domain 0.00046
Further Details:      
 
Domain Number 2 Region: 339-531
Classification Level Classification E-value
Superfamily Fibronectin type III 5.91e-24
Family Fibronectin type III 0.0028
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000026089
Domain Number - Region: 141-191
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000211
Family B-box zinc-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000026089
Sequence length 718
Comment (Rattus norvegicus)
Sequence
MEEEAGEEPGLGRSTAPRDFHFYHMDLYDSEDRLQLFPGESSRTRREVTQAEDEHELGGE
FVDEHRLGTLGYPYGMRRRDPGREQRDWGLSGEAAEAEDLCYGVQGPPDQCQDLREAYRY
THGRASEEYECYVIPEEEDEEEPADVFCVTCKTPVRTVEKDFDIHKEHEVTPINKALEHA
KDEIHKNMCKLEQQIIEMENFASHLEEVFITVEENFGRQEQNFECHYNEILETLAQKYEE
KIQALGEKKKEKLEALYGQLVSCGENLDACRELMETIEEMCHEEKVDFLKDAVAMTDRLG
KFLKTKTDVELSAKPEFEDQTLDFSDVEQLMDSINTVPAPSAPVINPQAPNSATGSSVRV
CWSLYSDDTVESYQLSYRPVQDSSPGKDQAEFTMTVKETYCSVKNLEPNTQYEFWVIAQN
RTGPSPSSEHVVYMTAPSPPSIKTEAIRSCEEAVLICWESGNLNPVDSYTVELIQAETPE
ASGVTESVVGIPTCESLIQLQPRHSYTIYVRALNVGGTSARSKPATVHTTGSYFQLNKDT
CHPWLTISEDGFTVVRSEKKRSFRRELPPSKAQFTRCVAVMGNLIPVRGRHYWEVEVDEH
LDYTVGVACEDVPKQEDLGANRLSWCMRHTFASTRHRYEFLHNGTTPDIRITVAPKKIGV
LLDYEDSKLSFFNVDIAQHLYTFSCPLHQFVHPCFSLEKSGGLKICNGISAPKHVTFF
Download sequence
Identical sequences ENSRNOP00000026089 10116.ENSRNOP00000026089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]