SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000026359 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000026359
Domain Number 1 Region: 228-303
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.68e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.000038
Further Details:      
 
Domain Number 2 Region: 95-163
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000119
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 3 Region: 9-80
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000584
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000361
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000026359
Sequence length 311
Comment (Rattus norvegicus)
Sequence
MDTGVIEGGLNVTLTIRLLMHGKEVGSIIRKSRESVKKLQEKGARINISEGNCPERIITL
AGPTNAIFKAFAMIIDKPEEDISSSMTNSTAASRPPVTVVPASQCGSLIGKGKIKEIRES
TGAQVQAAGNMLPNSTERAITIAGILPSIIECVKQICVVMLETPRRAYWPKPSSSPVIFA
GGQACTIQGHYAMPQPDLTKLHHMTHGNTGFSGIESSSPEVKGYLGLDESAQTTSHELTL
PNDLIGCIIGRQDAKINEIRQMSGAQIKTANPVEGSTDRQVTITGPAASISLAQYLINAR
LSSETGGKGSS
Download sequence
Identical sequences ENSRNOP00000026359 10116.ENSRNOP00000026359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]