SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000026704 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000026704
Domain Number 1 Region: 130-199
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 6.8e-18
Family F1F0 ATP synthase subunit C 0.011
Further Details:      
 
Domain Number 2 Region: 44-112
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 2.35e-16
Family F1F0 ATP synthase subunit C 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000026704
Sequence length 205
Comment (Rattus norvegicus)
Sequence
MTGLELLYLGIFVAFWACMIVVGICYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISL
SVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSA
TDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVE
IFGSAIGLFGVIVAILQTSRVKMGD
Download sequence
Identical sequences B0K022 Q91VS4
ENSRNOP00000026704 10116.ENSRNOP00000026704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]