SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000027603 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000027603
Domain Number 1 Region: 11-152
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.77e-48
Family Galectin (animal S-lectin) 0.0000688
Further Details:      
 
Domain Number 2 Region: 190-326
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.9e-45
Family Galectin (animal S-lectin) 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000027603
Sequence length 326
Comment (Rattus norvegicus)
Sequence
MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSIYIQGIAKDNMRRFHVNFAVGQDEGADI
AFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGHHFELVFMVMSEHYKVVVNGTP
FYEYGHRLPLQMVTHLQVDGDLELQSINFLGGQPAASQYPGTMTIPAYPVKSAGYNPPQM
NSLPVMAGPPIFNPPVPYVGTLQGGLTARRTIIIKGYVLPTAKNLIINFKVGSTGDIAFH
MNPRIGDCVVRNSYMNGSWGSEERKIPYNPFGAGQFFDLSIRCGTDRFKVFANGQHLFDF
SHRFQAFQRVDMLEIKGDITLSYVQI
Download sequence
Identical sequences ENSRNOP00000047505 10116.ENSRNOP00000027603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]