SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000027620 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000027620
Domain Number 1 Region: 7-135
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.6e-41
Family Galectin (animal S-lectin) 0.00000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000027620
Sequence length 136
Comment (Rattus norvegicus)
Sequence
KSATHHKTPLPQGVRLGTVMRIRGVVPDQAGRFHVNLLCGEEQEADAALHFNPRLDTSEV
VFNTKQQGKWGREERGTGIPFQRGQPFEVLIITTEEGFKTVIGDDEYLHFHHRMPSSNVR
SVEVGGDVQLHSVKIF
Download sequence
Identical sequences F8WG95
ENSRNOP00000027620 10116.ENSRNOP00000027620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]