SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000028100 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000028100
Domain Number 1 Region: 210-390
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-31
Family SPRY domain 0.014
Further Details:      
 
Domain Number 2 Region: 423-573
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000518
Family Nucleotide and nucleoside kinases 0.029
Further Details:      
 
Domain Number 3 Region: 2-40
Classification Level Classification E-value
Superfamily SAP domain 0.0000000104
Family SAP domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000028100
Sequence length 859
Comment (Rattus norvegicus)
Sequence
MDVRRLKVNELREELQRRGLDTRGLKAELAERLLAALEAEEPEDERELEADDEPGLPGHN
NEEVETEGGSELEGTAQPPPPGLQPHPEPGGYSGPDGHYVMDNITRQNQFYETPVIKQEN
ESVYDRRPLDMEPPQQAYRPELKTETKQEAPPSFLPPEASQLKTDRPQFQNRKRPFEENR
GRGYFEHREDRRGRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFKVARDRSSGYPLTIEGF
AYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEP
FSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQ
KEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSILPGFTFIQHLPLSERIRGTIGPKSKA
ECEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDV
LIQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLK
DRTIKRTDEEGKDVPDHAVLEMKANFTLPDVGDFLDEVLFIELQREEADKLVRQYNEEGR
KAGPPPEKRFDNRGGGFRGRGGGGSFQRYDNRGPPGGNRGGFQNRGGGGGSGGGGGNYRG
GFNRSGGGGYNQNRWGNNNRDNNNSNNRGSYNRAPQQQPPPQQPPPPQPPPQQPPPPPSY
SPARNPPGASSYNKNSNIPGSSANTSTPTVSSYSPPQPSYSQPPYNQGGYTQGYTAPPPP
PPPPPAYNYGSYGPYNPAPYTPPPPPTAQTYPQPSYNQYQQYAQQWSQYYQNQSQWPPYY
GNYDYGGYSGSTQGGTSTQ
Download sequence
Identical sequences D4A962
ENSRNOP00000028100 NP_001101947.1.100692 NP_001101947.1.4139 10116.ENSRNOP00000028100 ENSRNOP00000028100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]