SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000028298 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000028298
Domain Number 1 Region: 332-424
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.96e-25
Family Tudor domain 0.00000382
Further Details:      
 
Domain Number 2 Region: 122-203
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.78e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000067
Further Details:      
 
Domain Number 3 Region: 50-121
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.07e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000028298
Sequence length 560
Comment (Rattus norvegicus)
Sequence
MSTERTSWTNLSTIQKIALGLGIPASATVAYILYRRYRESREERLTFVGEDDIEIEMRVP
QEAVKLIIGRQGANIKQLRKQTGARIDVDTEDVGDERVLLISGFPVQVCKAKAAIHQILT
ENTPVFEQLSVPQRSVGRIIGRGGETIRSICKASGAKITCDKESEGTLLLSRLIKISGTQ
KEVAAAKHLILEKVSEDEELRKRIAHSAETRVPRKQPISVRREEVTEPGGAGEAALWKNT
NSSMGPAAPLEVPLRKGGGDMVVVGPKEGSWEKPNDDSFQNSGAQSSPETSMFEIPSPDF
SFHADEYLEVYVSASEHPNHFWIQIIGSRSLQLDKLVSEMTQHYENSLPEDLTVHVGDIV
AAPLSTNGSWYRARVLGTLENGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECS
LARIAPSGEEWEEEALDEFDRLTHCADWKPLVAKISSYVQTGISTWPKVYLYDTSNGKKL
DIGLELVRKGYAVELPEDMEENRTVPDMLKDMATETDDSLASILTETKKSPEEIPHTLSC
LSLSEAASMSGDDNLEDDLF
Download sequence
Identical sequences G3V8T7
ENSRNOP00000028298 ENSRNOP00000028298 10116.ENSRNOP00000028298 NP_001014060.2.100692 NP_001014060.2.4139 XP_006232932.1.100692 XP_006232933.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]