SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000028393 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000028393
Domain Number 1 Region: 52-287
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.3e-69
Family Calponin-homology domain, CH-domain 0.0000184
Further Details:      
 
Domain Number 2 Region: 2406-2523
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-31
Family Pleckstrin-homology domain (PH domain) 0.00012
Further Details:      
 
Domain Number 3 Region: 303-424
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-31
Family Spectrin repeat 0.00016
Further Details:      
 
Domain Number 4 Region: 1565-1721
Classification Level Classification E-value
Superfamily Spectrin repeat 2.07e-28
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 5 Region: 433-535
Classification Level Classification E-value
Superfamily Spectrin repeat 6.96e-23
Family Spectrin repeat 0.00051
Further Details:      
 
Domain Number 6 Region: 846-978
Classification Level Classification E-value
Superfamily Spectrin repeat 9.95e-23
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 7 Region: 1886-2042
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-22
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 8 Region: 1778-1927
Classification Level Classification E-value
Superfamily Spectrin repeat 5.08e-21
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 9 Region: 1250-1402
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-19
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 10 Region: 527-648
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-17
Family Spectrin repeat 0.00098
Further Details:      
 
Domain Number 11 Region: 739-835
Classification Level Classification E-value
Superfamily Spectrin repeat 3.54e-16
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 12 Region: 1083-1198
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000372
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 13 Region: 2044-2106
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000331
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 14 Region: 647-768
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000054
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 15 Region: 1402-1515
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000259
Family Spectrin repeat 0.0033
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000028393
Domain Number - Region: 993-1077
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00384
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000028393
Sequence length 2561
Comment (Rattus norvegicus)
Sequence
MAQVPGEVDNMEGPAASNNNNPAARWESPDRGWDREPPAAANAAASLFECSRIKALADER
EAVQKKTFTKWVNSHLARVGCHIGDLYADLRDGFVLTRLLEVLSGEQLPRPTRGRMRIHS
LENVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIILRFQIQVIKIETEXXXET
RSXKDAFVLYASVSVCIYVCVRVSNHLELWLNGRAFSLHVHRHMPDLVDLSKLTKSNANY
NLQRAFRTAEQHLGLARLLDPEDVNMEAPDEKSIITYVVSFYHYFSKMKALAVEGKRIGK
VLDQVLEVDKIIERYEELAAELLAWIHRTVDLISNQKFANSLSGVQQQLQAFTAYCTLEK
PVKFQEKGNLEVLLFSIQSKLRAHNRRLFVPREGCGIWDIDKAWGELEKAEHEREAALRA
ELIRQEKLELLAQRFDHKVAMRESWLNENQRLVSQDNFGYELPAVEAAMKKHEAIEADIA
AYEERVQGVAELAQALAAEGYYDARRVAAQRDSVLRQWALLTGLVGARRTRLEQNLALQK
VFQEMVYMVDWMEEMQTQLLSRECGQHLVEADDLLQKHGLLEGDIAAQSERVEALNAAAL
RFSQLQGYQPCDPQVICNRVNHVHGCLSELQEQAARRRAELEASRSLWALLQELEEAESW
ARDKERLLEATSGSGGAAGTAGGAHDLSSTARLLAQHKILQGELGGRRALLQQALRRGEE
LAAAGGSVGPGAEPLHLAGLAERAASARRRWQRLEEAAARRERRLQEARALHQFGADLDG
LLDWLRDAYRLAAAGDFGHDEASSRRLARQHRALTGEVEAHRGPVGGLRRQLATLGGASG
AGPLVVALQVRVVEAEQLFAEVTEVAALRRQWLRDALAVYRMFGEVHACELWIGEKEQWL
LAMRVPDSLDDVEVVQHRFESLDQEMNSLMGRVLDVNQTVQELVEGGHPSSDEVRSCQDH
LNSRWNRIVELVEQRKEEMSAVLLVENHVLEVAEVRAQVREKRRAVESAPRAGGALQWRL
SGLEAALQALEPRQAALLEEAALLAERFPAQATRLHQGAEELGAEWGALAGAAQACGEAV
AAAGRLQRFLRDLDTFLDWLVRAQEAAGAVEGPLPRSLEEADGLLARHAALKEEVDQREE
DYARIVAASEALLASDGAELGPGLALDEWLPHLEVGWHKLLGLWEERREALVQAHVYQLF
LRDLCQALAVLRNQEVALSGAELPCTVESVEEAMKRHRDFLTTMELNQQKMQVAVQAAEG
LLRQGNAYGEQAQEAVARLLEKSQENQLRAQQWMQKLLDQLVLQHFLRDCHELDGWIHEK
MLMARDGTREDSHKLHKRWLRHQAFMAELAQNKEWLEKIEREGQQLMQEKPELAASVRKK
LGEIRQCWAELESTTQAKARQLFEASKADQLVQSFAELDKRLLHMESQLQDVDPGGDLAT
VNSQLKKLQSMESQVEEWCREVGELQAQTAALPLEQASKELVGERQSAVGERLVRLLEPL
QERRRLLLASKELHQVAHDLDDELAWVQERLPLAMLTERGTGLQAVQQHIKKNQGLRREI
QAHGPRLEEVLERAGVLASLRSPEAEAVRRGQEQLQSAWTGLREATERRQQTLDAAFQVE
QYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGVENYEESIAQLSRQC
RALLEMGHPDSEQISRRQSQVDRLYVALKELGEERRVSLEQQYWLYQLSRQVDELEHWIA
EKEVVAGSPELGQDFEHVSVLQEKFSEFASETGTAGRERLAAVNQMVDELIECGHTAAAT
MAEWKDGLNEAWAELLELMGTRAQLLAASRELHKFFSDARELQGQIEEKRRRLPRLTAPP
EPRPSASSMQRTLRAFEHDLQLLVSQVRQLQEGAAQLRTVYAGEHAEAIASREQEVLQGW
KELLAACEDARLHVSSTADALRFHSQARDLLSWMDGIAGQIGAADKPRDVSSVEVLMNYH
QGLKTELEARVPELTACQELGRSLLLNKSAMADEIQAQLDKLGSRKEEVSEKWDRHWEWL
QQMLEVHQFAQEAVVADAWLTAQEPLLQSRELGSSVDEVEQLIRRHEAFRKAAAAWEERF
SSLRRLTTIEKLKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGYDRGLEPLARRA
SDTLSAEVRTRVGYVRQELKPERLQPRIDRLPETSGKVEPAAPTAAALDTTDTPGTPAVT
EQVRPRPERQELADRAEELPRRRRSERQESTDQPEEAARRRRPERQESADHEGPHSLTLG
RYEQMERRRERRERRIERQESSEQETPTRGELVKGKATLADIVEQLQEKEAGPGLPAAVP
SLPQPRELPPGRLPNGLEPPERTPRPDRPRARDRPKPRRRPRPREGGEGGGSRRSRSAPA
QGGSAPAPPPPPTHTVQHEGFLLRKRELDANRKSSNRSWVNLYCVLSKGELGFYKDSKGP
ASGGTHGGEPLLSLHKATSEVASDYKKKKHVFKLQTQDGSEFLLQAKDEEEMNGWLEAVA
NSVAEHAEIARWGQTLPTTSSTDEGNPKREGGERRASGRRK
Download sequence
Identical sequences ENSRNOP00000028393 10116.ENSRNOP00000028393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]