SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000028698 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000028698
Domain Number 1 Region: 57-158
Classification Level Classification E-value
Superfamily POZ domain 2.75e-29
Family Tetramerization domain of potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000028698
Sequence length 283
Comment (Rattus norvegicus)
Sequence
MPHRKERPSGSSLNAHGSSGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKANAPVHI
DVGGHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYILSFLRTS
KLLLPDDFKDFNLLYEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGER
IALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQVLERLFQRG
FSVAASCGGGVDSSQFSEYVLCREERRPQPTPTAVRIKQEPLD
Download sequence
Identical sequences B5DF44
10116.ENSRNOP00000028698 ENSRNOP00000028698 RnR328 NP_001102611.1.100692 NP_001102611.1.4139 XP_006228921.1.100692 XP_006228922.1.100692 XP_008757400.1.100692 ENSRNOP00000028698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]