SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000029108 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000029108
Domain Number 1 Region: 955-1082,1114-1320
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.1e-65
Family p120GAP domain-like 0.0003
Further Details:      
 
Domain Number 2 Region: 26-190
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.2e-38
Family Calponin-homology domain, CH-domain 0.0000263
Further Details:      
 
Domain Number 3 Region: 1535-1632
Classification Level Classification E-value
Superfamily RGC domain-like 1.44e-29
Family RGC domain 0.0000112
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000029108
Domain Number - Region: 733-818
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000319
Family Motor proteins 0.036
Further Details:      
 
Domain Number - Region: 670-696
Classification Level Classification E-value
Superfamily WW domain 0.000575
Family WW domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000029108
Sequence length 1632
Comment (Rattus norvegicus)
Sequence
MESCTAGQARTAYDRLTAEEMDEQRRQNVAYQYLCRLEEAKRWMEVCLKEELPSPVELEE
SLRNGVLLAKLGHCFAPSVVPLKKIYDMEQLRYQATGLHFRHTDNINFWLSAVAHIGLPS
TFLPETTDIYDKKNMPRVIYCIHALSLFLFRLGLAPQIHDLYGKVKFTAEELSNIASELA
KYGLQLPAFSKIGGILANEFSADEAAVHAAILAINDAVERGVVEDTLVALQNPNALLGNL
REPLAAVYQELLALAKMEKAANARNHDDGQDQDIYESCLTQAEIQGHINLANVQGALEVV
DDALERQSPEALLEALRDPVLALQGVRQAFADWYLEQLTSDREQKSQELGLVRLLEKEEI
QAGVAAANEKGDQEQAMLRAVWKINKAIQRGVAADTVKELMCPEAQLPQVYPFASAVYQQ
ELALLQKQQQGELDQEELFVAVEMLSAVVLINRALEAGDACTFWDNLVNPATGLAQVEEE
NAQRYFDALVKVQQLRGTHRGFLSWNDLQAAVSQVNAQVQEETDQVLAISLINEALDQGC
PEKTLSALLLPAAGLEDVSLPVAPRYHHLLVAAKRQKAQKTGDPGAVLWLEEIRQGVARA
NEDTNTAQRIALGVAAINQAIKEGKAAQTERVLRNPNVALRGIVPDCAKSYQQALEGAAA
KKHRPGDTAFWVPRDMKDGTAYYFHLQTFQGTWERPPSRHLNASHLTWEEIQSVITKVTA
AHDRQLLWKANVGFVIKLQARLRGFLVRQKFAESSHFLRTLLPAVIKIQAHWRGYRQRKT
YQERLQYFKANLNAIITIQAWARMWAARRQYLRRLRYFQKNVDSVVKIQAFFRARKARDD
YRMLVHARHPPLSVVRKFAHLLNQSQEDFSAEAELLRLQEEVVRKIRSNQQLEQDLNLMD
IKIGLLVKNRITLQEVVSHCKKLTKKNKEQLSDMMILDKQKGLKSLSREKRQKLEAYQHL
FYLLQTQPIYLAKLIFQMPQNKTTKFMEGVIFSLYNYASNRREAYLLLQLFRTALQEEIK
SKVEQPQDVVTGNPTVVRLVVRFYRNGRGQSALQEILGKVIQDVLEDRSVSIHTDPVHIY
KSWINQVEAQTGQRSHLPYDVTPEQALSHSEVQRRLDISLRNLLAMTEKFFVAISSSVDH
IPYGIRYMAKVLKTTLETKFPNATERDIYKVVGNLLYYRFLNPAVVAPDAFDIVAMAAGS
SLAAPQRHALGAVAQLLQHAAAGKVFSGESRHLRILNGYLEDLHHKFRKFICRACRVPEP
EERFAIDEYSDMVAVAKPMVYITVGELIGTHRLLLEHQDQLAPGHQDPLHQLLEDLGEPP
TITDLIGDHVATDGHEDLSRLEVSLTLTNKFEGLETDADHNSTQSLLLSTKQMLADLIQF
HPGDSLEEILTSSAPREHEEAHHRLMCWRQACDTQKPEPLQRRHSLMAHSLLPLAEKQQR
VLRNLRRLQGLGLVRANDCYQGLVDELAKDICNQRRHRQRRKAEMLRLRATLQGLDAKTI
FYEEQGDYYNQYTQACLDHLAPNPRSSGKGKKQPSLHYTAAQLLEKGVLVEIEDLPVSHF
RNVIFDITPGDEAGRFAVNAKFLGVDMEKFQLHYQDLLQLQYEGVAVMKLFNKAKVNVNL
LIFLLNKKFLRK
Download sequence
Identical sequences D3ZCS4
ENSRNOP00000029108 10116.ENSRNOP00000029108 ENSRNOP00000029108 NP_001178638.1.100692 NP_001178638.1.4139 XP_017446368.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]