SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000029158 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000029158
Domain Number 1 Region: 129-284
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-34
Family SPRY domain 0.0015
Further Details:      
 
Domain Number 2 Region: 2-79
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000401
Family Fibronectin type III 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000029158
Sequence length 310
Comment (Rattus norvegicus)
Sequence
MPEEDNKIDHFIMEYRKTNFEGLPRVKDERCWEVIDNIKGTEYTLSGLKFDSKYMNFRVR
ARNKAVAGEYSDPVTLETKALNFSLDNSSSHLNLKVEDSCVEWDPTGGKGQESKIKGKEN
KGRSGTPSPKRTSVGSRPPAVRGSRDRFTGESYTVLGDTAIENGQHYWEVKAQKDCKSYS
VGVAYKTLGKFDQLGKTNTSWCIHVNSWLQNTFAAKHNNKVKALDVPVPEKIGVFCDFDG
GQLSFYDAHSKQLLYSFKTKFTQPVVPGFMVWCGGLSLSTGMQVPSAVRTLQKSENGMTG
SASSLNNVTQ
Download sequence
Identical sequences 10116.ENSRNOP00000029158 ENSRNOP00000029158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]