SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000029373 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000029373
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.76e-33
Family Calponin-homology domain, CH-domain 0.0000551
Further Details:      
 
Domain Number 2 Region: 835-900
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000824
Family p120GAP domain-like 0.027
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000029373
Domain Number - Region: 636-701
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000478
Family Motor proteins 0.053
Further Details:      
 
Domain Number - Region: 547-578
Classification Level Classification E-value
Superfamily WW domain 0.00263
Family WW domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000029373
Sequence length 900
Comment (Rattus norvegicus)
Sequence
RWMEVCLVEELPPTTELEEGLRNGVYLAKLAKFFAPKVVSEKKIYDVEQSRYKKSGLHFR
HTDNTVQWLRAMEAIGLPKIFYPETTDVYDRKNIPRMIYCIHALSLYLFKLGIAPQIQDL
LGKVDFTEEEISNMRKELEKYGIQMPAFSKIGGILASELSVDEAALHAAVIAINEAIEKG
VAKQTIITLRNPNAVLTCVDDSLSQEYQKELWEAKKKKEETAKLKNSCISEEERDAYEEL
LTQAEIQSNIHAVNRMAAVDHINAVLREGDPENTLLALKKPEAQLPAVYPFAAAMYQNEL
FNLQKQNTSNYLAHEELLIAVEMLSAVALLNQALESNDLVAVQNQLRSPTIGFNNLDEAH
VDRYADALLSVKQEALSQGQDTLSWNEIQNCIDMINNQIQEENERMVVLGYINEAIDEGN
PLKTLDTLLLPTANIRGVDPDCAHHYQDVLFHTKSQKLRDPKNVSKVLWLDEIQQAINEA
NVDKNRAKQWVTLVVGVNECLDRKQSDDILTVLKSSSSNVHNILPECANKYFDTLMKAKE
SKTDGEPTEGPWVKLDVQQKYNYYYNTDSKEGSWIPPESCLCKESWLTGEEIEDIVEKVT
SDYIRENLWSASEDLLLRFEATNSGPILREEFEARKAFLYKQVGNVVKIQAFWKGYKQRQ
EYLHRQQVFARNVDSVVKIQSWFRMVTARKSYLSRLQYFEDHENEIVKIQSLLRASKARD
DYKALVGSENPPLTVIRKFVYLLDQSDLDFQEELEVARLREEVVTKIRANQQLEKDLNLM
DIKIGLLVKNRITLEDVISHSKKLNKKKGGEIEILTNTDNQGIKSLSKERRKTLETYQQL
FYLLQTKPSYLAKLIFQMPQNKSTKFMDTVIFTLYNYASNQREEYLLLKLFKTALEEEIK
Download sequence
Identical sequences 10116.ENSRNOP00000029373 ENSRNOP00000029373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]