SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000031076 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000031076
Domain Number 1 Region: 378-565
Classification Level Classification E-value
Superfamily Fibronectin type III 1.07e-31
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 2 Region: 248-374
Classification Level Classification E-value
Superfamily Fibronectin type III 5.65e-26
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 3 Region: 2-131
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-18
Family Laminin G-like module 0.0064
Further Details:      
 
Domain Number 4 Region: 141-251
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000604
Family Fibronectin type III 0.0038
Further Details:      
 
Domain Number 5 Region: 554-668
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000317
Family Fibronectin type III 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000031076
Sequence length 684
Comment (Rattus norvegicus)
Sequence
MQMELKSGLLSFQLNSSRILTRVEVRLGRTHCDGKWNRVTIRREGSMVSVGVNELTKSTS
RAGDQPPLLTSPVYLGGIPQELQASYRHLTLEQGFRGCVKEVAFTRGAVVNLASVSSRAV
RVNQDGCLSSDSTVNCGGNDSILVYRGSRQSVYESGLQPFTEYLYRVTASHKGGSVSSDW
SRGRTLGSAPHSVPTPSRAQSINGYSVEVAWNEPAMVKGVLEKYILKAYSEDSAQPHMPS
ASTEFNNTDIRTGILTGLHPFHSYAVTLTACSRAGCTESSRALSISTPQEAPQEVQAPVA
EALPNSLSFFWSPPRQANGIITQYSLYMDGRLVYTGKGQNYTVTDLRVFTAYEITVGACT
RAGCTNSSRVILHTAQLPPERVDPPVLAILDSRTVHIQWKQPRQLNGILERYILYTLNPT
HNSTVWDVVYNSTENLQTHLLYHLSPGCLYLIKLGACTGGGCTTSEPSQALMDETVPEGV
PAPRAHSHSPDSFNISWTEPGHPNGVITTYELYLDGTLIHNSSELSCHAYGFDPGSLHTF
QVQACTAKGCALGPLVENRTLEAPPEGTVNLFVKPEGSREAAVRWDAPPHPNGRLTYSVL
ITGNFYADQAGDNYTLLSSTKTVHSSKGDRLWVLVDRLVPCSNYTVQVNASNSQGSVLSD
RVSVEMPPGGEVKSFVGFLNLTRR
Download sequence
Identical sequences 10116.ENSRNOP00000031076 ENSRNOP00000031076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]