SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000032591 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000032591
Domain Number 1 Region: 1066-1394
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.96e-84
Family Ankyrin repeat 0.00000734
Further Details:      
 
Domain Number 2 Region: 222-546
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.25e-77
Family Ankyrin repeat 0.0000256
Further Details:      
 
Domain Number 3 Region: 482-704
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.03e-58
Family Ankyrin repeat 0.0000756
Further Details:      
 
Domain Number 4 Region: 1711-1781
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.8e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000032591
Sequence length 2592
Comment (Rattus norvegicus)
Sequence
MEKATVPAAAEGEGSPPAAAAVAAPPAAAEVGGGARSASSPRGMVRVCDLLLKKKPPQQP
HHKAKRNRTCRPPSSSESSSDSDNSGGGGGGGGGGTSSNNSEEEEDDDDEEEEVSEVESF
ILDQDDLENPMLETASKLLLSGTADGADLRTVDPETQARLEALLEAAGIGKLSTADGKAF
ADPEVLRRLTSSVSCALDEAAAALTRMRAESTANAGQSDNRSLAEACSEGDVNAVRKLLI
EGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGIKGDITPLMAAANGGHVK
IVKLLLAHKADVNAQSSTGNTALTYACAGGYVDVVKVLLESGASIEDHNENGHTPLMEAG
SAGHVEVARLLLENGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMH
TALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGHVELAALLIERGASLEE
VNDEGYTPLMEAAREGHEEMVALLLGQGANINAQTEETQETALTLACCGGFLEVADFLIK
AGADIELGCSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADV
LLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGANVNRTTANNDHTVLSLACAGG
HLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTSVVCYLLDYPNNLLAAPPPDVTQLT
PPSHDLNRAPRVPVQALPMVVPPQEPDKPPANVAATLPVRNKAASKQKSNSHLPANSQDV
QGYITNQSPESIVEEAQGKLTELEQRIKEAIEKNAQLQSLELAHADQLTKEKIEELNKTR
EEQIQKKQKILEELQKVERELQLKTQQQLKKQYLEVKAQRIQLQQQQQQSCQHLGLLTSV
GVGEPLPEGDYARLQQVDPVLLKDEPQQTAAQMGFAPIQPLAMPQALPLAAGPLPPGSIA
NLTELQGVIVGQPVLGQAQLAGLGQGILTETQQGLMVASPAQTLNDTLDDIMAAVSGRAS
AMSNTPTHSIAASVSQPQTPTPSPIISPSAMLPIYPAIDIDAQTESNHDTALTLACAGGH
EELVQTLLERGASIEHRDKKGFTPLILAATAGHVGVVEILLDNGADIEAQSERTKDTPLS
LACSGGRQEVVELLLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGS
KLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRTEVVSLLLDRK
ANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHYKF
CELLIGRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVQAGADVDAADNRKITPLMAAFR
KGHVKVVRYLVKEVNQFPSDSECMRYIATITDKEMLKKCHLCMESIVQAKDRQAAEANKN
ASILLEELDLEKLREESRRLALAAKREKRKEKRRKKKEEQRRKLEEIEAKNKENFELQAA
QEKEKHKVEEEPEVLTEPPSATTTTTIGISATWTTLAGSHGKRNNTITTTSSKRKNRKNK
ITPENVQIIFDDPLPISYSQPEKASGESKSSSTSESGDSDNMRISSCSDESSNSNSSRKS
DNHSPAVATATVASKKQPSVLVTFPKEERKSVSGKASIKLSETVNEGTSNSLSTCTKSGP
SPLSSPNGKLTVASPKRGPKREEGWKEVVRRSKKVSVPSTVISRVIGRGGCNINAIREFT
GAHIDIDKQKDKTGDRIITIRGGTESTRQATQLINALIKDPDKEIDELIPKNRLKSSSAN
SKIGSSAPTTTAANSSLMGIKMTSVALSSTSQTATALTVPAVSSASTHKTIKNPVNNVRP
GFPVSLPLAYPPPQFAHALLAAQTFQQIRPPRLPMTHFGGTFPPAQSTWGPFPVRPLSPA
RATNSPKPHMVPRHSNQNSSGSQVNSAGSLTSSPTTTTSSSASAVPGTTSNGSPSSPSVR
RQLFVTVVKTSNATTTTVTTTASNNSTAPTNATYPMPTAKEHYPVSSPSSPSPPAQPGGV
SRNSPLDCGSASPNKGASSSEQEASSPPVVETTNSRPSHSSTSSGSSSGHSTQQQPPGSV
PQEPRPPLQQSQVPSPDVRMTVPPTATSSAPVVVPSTAPMTYPMPQTQMGCSQPPKMETP
AIRPPSHGTTAPHKNSAPVQNSSVAVLNVNHIKRPHSVPSSVQLPSTLSTQSACQNSVHP
ANKPVAPNFSAPLPFGPFSTLFENNPTNAHAFWGGPVVSSQSTPESMLSGKSSYLPNSDP
LHQSDTSKAPGFRPPLQRPAPSPSGIVNMDTPYGSVTPSSTHLGNFASSLSGGQMYGPGA
PLGGAPLGGAPAAANFNRQHFSPLSLLTPCSSASNESPAQSVSSGVRAPSPAPSSVPLGS
EKPSSVSQDRKVPVPIGTERSARIRQTGTSAPSVIGSNLSTSVGHSGIWSFEGIGGNQDK
VDWCNPGMGNPMIHRPMSDPGVFSQHQAMERDSTGIVTPSGTFHQHVPAGYMDFPKLGSM
PFSVYGNAMLPPVAPIPDGAGGPIFNGPHSADPSWNSLIKMVSSSTENNGPQTVWTGPWA
PHMNSVHMNQLG
Download sequence
Identical sequences ENSRNOP00000032591 10116.ENSRNOP00000032591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]