SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000032723 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000032723
Domain Number 1 Region: 6-100
Classification Level Classification E-value
Superfamily DEATH domain 9.42e-19
Family Caspase recruitment domain, CARD 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000032723
Sequence length 1098
Comment (Rattus norvegicus)
Sequence
MASEGASSEIIEKQRTKLLSVLQQDPDSILDTLTSRRLISEEEYETLEAITDPLKKSRKL
LILIQKKGEDSCCCFLKCLSNAFPQSASTLGLKQEVPRQGTGEVVEVSRGLEDPFSLGTI
TPEIAELSEEKECPGLGAPEFFTCKESSHREPEVPSWENQEGRGAQQVTAPRSVKGVEYE
VPASISLLSDGQRYEEPDDSLYLEEGEGEESLGYPEDVLEEGAGDDPQCFVYDSEEECEY
EENMGSSGEDSSCDDTSETCVPLEGEKSAEERKRVFQHVLSCLNMDRNRKLLPEFVRQFS
IDRGCEWTPKTPGDLAWNFLMKVQALDSTARDSILRPEVAGEENEELPAGIEKLGIGDPQ
TIHPLDVLCACMLCADSSLQREVMSNMYQCQFALPLLLPDAENNKNLLMVGAMKDLKQPS
AQSSGGPLRETDTFLGLTKMPVISFVRLGRCSFSKSRIVNTLLSSSQQKPYPIFLHQDLS
VPVLPRQISDGLVEVTWCFPDKLLKESPHAFQKPVAVANLRGDLESFWIQFGFLVEVSSG
LFFFTDCLGEKEWDLLMFLGEDTIERCYFILSPQAKESEEAQIFQRILKLKPSQLLFWEA
EEAGDRRKTMEALQAALQEVMSSPLRCVSLEEMASLARELGIQVDQDFEVTQDIQVSPTT
VEGENQQPCSQTKSPAESGAQEPIREPGAQCDDSQNAPVFHQTPVYMPYPAHPWPLPIKA
GGNFYHVPLNAPWVMGSHFGSQQRAKWFFPFPHQNTSVHSRGQNFSIKYFQPWRCYSRGR
FTNCSAKSQQNQNGPFGRSQRQTSHPENRQTSRTRQRSGTAASHVGHIHSSGSQATKATG
KPHSEKARAQGMQLTKAAGKSIRTQSHIKHPHPQPCQPAGAIQERIIPTSHQEAQRTTQG
RPSDLAFKPGSQSTSGNKHSSASQYNSHPPNFQSKHFQPKPFQPVPSHSQPSQAKPTHLN
PSPANYTHVQPSHAKPTHSKAFQANSHHPHPSHAKPTHLNPSHANPTHVQPSHAKPTHSN
LPKQNPPHPNLLSSRHTNLSSPSLSLLSRDPVSLNHPRPSLHRPGPPTQEQGDVKEHTLE
ICEIKYGLCLSYSSHIAV
Download sequence
Identical sequences D3ZVT3
NP_001099883.1.100692 NP_001099883.1.4139 10116.ENSRNOP00000032723 ENSRNOP00000032723 ENSRNOP00000032723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]