SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000034413 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000034413
Domain Number 1 Region: 82-209
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.1e-36
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000034413
Sequence length 341
Comment (Rattus norvegicus)
Sequence
MVGEMETKENPNPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDT
LNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCK
IMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLV
PAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAA
LRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSI
LEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRVNLGN
Download sequence
Identical sequences 10116.ENSRNOP00000034413 ENSRNOP00000023304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]