SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000034566 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000034566
Domain Number 1 Region: 334-502
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.89e-49
Family SPRY domain 0.0000696
Further Details:      
 
Domain Number 2 Region: 32-144
Classification Level Classification E-value
Superfamily Immunoglobulin 1.57e-18
Family V set domains (antibody variable domain-like) 0.00022
Further Details:      
 
Domain Number 3 Region: 151-231
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000575
Family C1 set domains (antibody constant domain-like) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000034566
Sequence length 589
Comment (Rattus norvegicus)
Sequence
MGIYCKPSVLFQDSYLLVLTQLLCWVTTKGFRVFGPSDPVVAAPGREAILPCSVSPAMSV
ENMEELRWFRTRFSQAVFVYRDQEEQKEEQMIEYSWRTSLVKDKFHEGKAAVRIQNVQES
DSGIYVCHFKQGHFHEEAILELKVAAMGSVPEVYIKGPEDGGVCVVCMTSGWYPEPQVHW
RDSRGEILPASSETLHEDAEGLITTETSLVLRDSSVRNVTCSTFNPVLGQEKAMAMVIPE
PFFPQASPWKTAFLVILTMMGLLVLGTISLFGWERFVRLKLQKEQIHIHCEKDELQTEKE
DALRTAKWWGYCEWVLTRVCSFTAWRKAQLYADWRKEHFQTWTFTLDPASAHPTLVISQD
RMRVTRKDTTVCLDDLFSVLGTKGISSGRYYWEVKLENREGSKWILGVCREGVERKGFYF
ESPEKGFWTVGQSSSGYWAYVDSGRDSLSIRQAPESVGVFVDYDKRNISFYNMSDMSHLF
SFHEASFSGTLLPYFQLKCGNVSMTVNSMACVSEGQEGEEGRKGRKRSRKGRKRRKGRRP
KKGKGLALLPLKESLSPTGEGLVPGSCVVVSPSGEESPFLQDARDTLFP
Download sequence
Identical sequences ENSRNOP00000034566 10116.ENSRNOP00000034566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]