SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000034649 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000034649
Domain Number 1 Region: 232-435
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-31
Family Leech intramolecular trans-sialidase, N-terminal domain 0.091
Further Details:      
 
Domain Number 2 Region: 628-768,798-817
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000107
Family Zinc protease 0.079
Further Details:      
 
Domain Number 3 Region: 842-896,1064-1107
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000204
Family Fibronectin type III 0.0058
Further Details:      
 
Domain Number 4 Region: 547-632,721-772
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000659
Family Zinc protease 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000034649
Sequence length 1122
Comment (Rattus norvegicus)
Sequence
MMCWKVLRISLVVLAGWAFSTTNSELGWTRKKYLAQRAHLNQALLEGERCWLAYKVRRPR
CAPQHHPFGVYPSHHENYLRSYPVGMQQTQYAEWSQRSTERQAPSGVPRDLTENPAGVKR
KSEQPAAPWVGDGPIGQSQLLRDDDTYLGKGGSKEALGEPAIRGSSETAVSTITTFTYQK
GPTAETQRKGQSKSRLPRQVQKRQAEDMTRDPQNTPQDVQLWPKDPLKHGDSNSPLEGTI
QNGGGASAQRAETFNPQGGLPVLYFSGKRERLLLRPEVLAEIPREAFTVEAWVRPEGGQS
NPAIIAGVFDNCSHTVNDKGWALGIRSGKDKGQRDARFFFSLRTDRMKKATTVIGHSRYQ
PGTWTHVAATYDGQHMALYVDGTRVAASPDQSGPLNSPFMASCRSLLLGGDNSENGHYFR
GYLGTLVIWSTALSQLHLQHSPQHPSGVDELTTLILTATFDPLKEQWAPFRDETYPLMEV
FQDSESQPEILSPLQPPPCGQTACDNVELISQYNTHGPLRREKVVRYQVVNICDDEGLHP
IVSDLQIRRQHEALNQAFSRYNISWQLSVHRVHNSTLRHRVVLVNCEPSKIGNDHCDPEC
EHPLTGFDGGDCRLQGRCYSWNRRDGLCHMECNNMLNDFDDGDCCDPEVTDVRKTCFDPD
SPKRAYMSVKELKEALQLNSTHFLNVYFASSVREDLAGSATWPWDKDALSHLGGVVLNPA
YYGMLGHTNIMIHEVGHVLGLYHVFKGVSERESCDDPCRETVPSMETGDLCADTAPTPKS
KLCRDPEPANDTCGFTLFPRAPFNNYMSYTDDDCTDNFTPNQVARMHCYLDLVYQQWSES
QKPTPIPIPPMVIGQTHKSLTIHWLPPISGVVYDRTPDSMCGACTEDGTFRQYVYKASSG
RVCDSSGYWTPEEAVGPPDVDQPCEPSLQAWSPELHLNHMNMTVPCPAEGCSLELLFQHP
VQADTLTLWVTYLSVNSSKAFFDIEILLEHKESMHLGPLNTFCDMPLTIKLHVDEKVVGA
KVYTFDERMEIDAALLTSRPSSSLCSGCRPVSYQVLREPPFSSGLPMVVTHPHRKFTDTE
VIPGQVYQYQVQAEAGGELGEASPPLSHIHGGPYCGDGKVER
Download sequence
Identical sequences ENSRNOP00000034649 10116.ENSRNOP00000034649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]