SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000035076 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000035076
Domain Number 1 Region: 190-358
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-50
Family SPRY domain 0.0000653
Further Details:      
 
Domain Number 2 Region: 1-50
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000214
Family B-box zinc-binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000035076
Sequence length 360
Comment (Rattus norvegicus)
Sequence
CGTHPEPSQLFSDEDQIIISSKCFQSPEHKRHEACGIQESAEYYREKLEAAACLLAEERE
RMVTIQVYNKGKKRITFKIRFNIQEFRFLAKVEKEYKLLKVNEELHLQRLSHLGSENMGK
LKASEAWLSEHLCSLQKIITDLERNCGESAVALLQNAECYLKRSESILLQSLEPAQITDL
SACRIIGTSNVLLRLQRHITLDPDTAHPSLVVSEDLRHVAFRDTPKTGPDTPRRFDFSAS
VLGAESFDSGRHYWEVAVGQATQWQVGICDCTERTNSIPGTSGDKVLLMGSLMGADCTLW
VFPPLRKVWLRKQMYKVGVFLDCECGQVSFYNVTEQSLIYSFSALTFRGAVKPIFSLCIT
Download sequence
Identical sequences ENSRNOP00000035076 10116.ENSRNOP00000035076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]