SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000035420 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000035420
Domain Number 1 Region: 629-780
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-17
Family Laminin G-like module 0.022
Further Details:      
 
Domain Number 2 Region: 419-608
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000143
Family Laminin G-like module 0.023
Further Details:      
 
Domain Number 3 Region: 831-1026
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000613
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 4 Region: 147-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000112
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 5 Region: 321-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000237
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 6 Region: 109-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000438
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 7 Region: 225-267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000024
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 8 Region: 1173-1214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000142
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 9 Region: 185-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000069
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 10 Region: 75-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000305
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 359-401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000041
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 12 Region: 1057-1096
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000838
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 13 Region: 263-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000292
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 1092-1129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000573
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000035420
Domain Number - Region: 805-844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family EGF-type module 0.0082
Further Details:      
 
Domain Number - Region: 847-875
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0188
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000035420
Sequence length 1283
Comment (Rattus norvegicus)
Sequence
MALLGPVIWGFRRDVYLLLLLLLLLLPPWVPAGLVPSETPNVCASDPCAPGTRCQATESG
GFTCEPLELGGCAAQPCHHGALCVPQGPDPNGFRCYCVPGFQGPHCELDIDECASRPCHH
GGTCRNLADHYECHCPLGYAGVTCEAEVDECSSAPCLHGGSCLDGVGSYRCVCAPGYAGA
SCQLDVDECQSQPCEHGGVCHDLVNGFRCDCADTGYEGARCEQEVLECASAPCVHNASCL
DGFRSFRCLCWPGFSGERCEVDEDECASDPCHNGGRCSQRSDPTLYGGVQAIFPGAFSFS
QAAGFLCSCPPGFAGDDCSVDVNECASEPCLNGGSCQDLPNGFQCYCQDGYTGLTCQEDT
DECQSEPCLHGGTCSDTVAGYICQCPEAWGGHDCSVQLTGCQGHACPLAATCIPTFKSGF
HSYICRCLPGTYGSFCDQNTTFSVVSGSSVWGLVPAGASLAFALRFRTTLLAGALATLKD
SRDSLELVLVGAMLQATLWRRGTADLVLTLPDLALNDGHWHQVEVTLRLGTLELRLWHEG
CPGQLCVVSGTVATDPTASVASGSPEPYSIHLGGRAFAGCFQDVRVEGHLLLPEELKGSV
LLGCERTEPCQPLPCANGGACVDLWTDFRCDCPRPYHGSKCTDEVPAATFGLGGVMSSAT
FLLHQMLGPNLTVSFFLRTREPASLLLQFANDSVASLTVSLSEGQIRAEVLGHPAVILPG
RRDDGLRHLVVLSFGPDQLQDLGQWLYVGGRLYPDDTQPWGGPFRGCLQDLQLNGIHLPF
FSSPMENSSWPSELEAGQSSNLTQGCVSEDTCNPNPCFNGGTCHITWNDFYCTCPDNFTG
PTCAQQRWCPRQPCLPPATCEEVPDGFVCVAEATFREGPPAVFTGHNVSSSRALSRVTLA
FRTRDLEAGLLRAASAAGAHSNIWLAVRNGLLAVDVAGSVLPAPGPRVADGAWHRVRLAR
EFPQAAASRWLLWLDGAATPVALHGLGGDLGFLQGPGAVPLLLAENFTGCLGRVALGDLP
LPLAPPRSGAMSGAREHFMAWPGSPPAVSLGCRGGPVCTPSPCLHGGACLDLFDVFACSC
GPAWEGPRCEIHADPCRSSPCVRGQCNTRPDGRFECRCPPGFSGPRCRLPTLPQGCSLNS
TCKDGAPCGGGPLGTNCSCQEGLAGLRCQSLDQPCEASPCLNGGTCRVTSGIFECTCSAG
FSGQFCEVVKTLPLPLPFPLLEVAVPAACACLLLLLLGLLSGILAARKRRQSEGTYSPSQ
QEVAGARLEMDSVLKVPPEERLI
Download sequence
Identical sequences D4A3W2
10116.ENSRNOP00000035420 ENSRNOP00000035420 ENSRNOP00000035420 NP_001129233.1.100692 NP_001129233.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]