SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000035496 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000035496
Domain Number 1 Region: 7-71
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000366
Family SAM (sterile alpha motif) domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000035496
Sequence length 185
Comment (Rattus norvegicus)
Sequence
MSAVSEVNVDIQDFLISINLEQYFLHFQEFGFYTVKDCATINYNEEISPTGHHRRILKQL
QMIFSKKQDFPIYANVYKTKNSSTPREQHSALSSSSNTCIDFSDSVTVRRPGPAPSEMVT
TSVLSEGNCHSSTSNDKLSLSSSDLPCPEEELHQNVDFSQDSLFGRVNVKIDSLITQQAV
EHAAG
Download sequence
Identical sequences ENSRNOP00000035496 ENSRNOP00000035496 10116.ENSRNOP00000035496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]