SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000035517 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000035517
Domain Number 1 Region: 2670-2958
Classification Level Classification E-value
Superfamily BEACH domain 2.49e-126
Family BEACH domain 0.0000000151
Further Details:      
 
Domain Number 2 Region: 3065-3244,3375-3420
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.16e-31
Family WD40-repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 2516-2638
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-22
Family PreBEACH PH-like domain 0.017
Further Details:      
 
Domain Number 4 Region: 3428-3495
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.3e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0014
Further Details:      
 
Domain Number 5 Region: 1087-1286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000222
Family Vibrio cholerae sialidase, N-terminal and insertion domains 0.078
Further Details:      
 
Domain Number 6 Region: 473-514,580-768,840-907
Classification Level Classification E-value
Superfamily ARM repeat 0.00000441
Family HspBP1 domain 0.073
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000035517
Domain Number - Region: 1410-1461,1513-1579,1614-1704
Classification Level Classification E-value
Superfamily ARM repeat 0.000179
Family HspBP1 domain 0.05
Further Details:      
 
Domain Number - Region: 2344-2403
Classification Level Classification E-value
Superfamily Cyclin-like 0.00442
Family Retinoblastoma tumor suppressor domains 0.017
Further Details:      
 
Domain Number - Region: 117-390
Classification Level Classification E-value
Superfamily ARM repeat 0.00561
Family Mo25 protein 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000035517
Sequence length 3505
Comment (Rattus norvegicus)
Sequence
MNMVKRIMGRPRQEECSPQDNALGLMHLRRLFTELCHPPRHMTQKEQEEKLYMMLPVFNR
VFGNAPPSTMTEKFSDLLQFTTQVSRLMVTEIRRRASNKSTEAASRAIVQFLEINQSEEA
SRGWMLLTTINLLASSGQKAVDCMTTMSVPSTLVKCLYLFFDLPHVPEAGGGAQSELPLA
ERRGLLQKAFVQILVKLCSFVSPAEELAQKDDLQLLFSAITSWCPPYNLPWRKSAGEVLM
TISRHGLSVNVVKYIHEKECLSTCVQNMQQSDDLSPLEIVEMFAGLSCFLKDSSDVSQTL
LDDFRIWQGYNFLCDLLLRLEQAKEAECRDALKDLVSLVTSLTTYGVSELKPAGVTTGAP
FLLPGFSVPQPAGKGHSVRNIQAFAVLQNAFLKAKTNFLAQIILDAITDIYMADSANYFI
LESQHTLSQFAEKISKLPEVQSKYFEMLEFVVFSLNYIPCKELISVSILLKSSSSHHCSI
VAMKTLLKFTRHDYIFKDVFREVGLLEVMVNLLHKYAALLKDPAQALGEQGDSRNNSSVE
DQKHLALLVMEALTVLLQGSNTNAGIFREFGGARCAHNIVKYPQCRQHALMTIQQLVLSP
NGEDDMGTLLGLMHSAPPTELQLKTDILRALLSVLRESHRSRTVFRKVGGFVYITSLLVA
MERSLSSPPKNGWEKVNQNQVFELLHTVFCTLTAALRYEPANSHFFKTEIQYEKLADAVR
FLGCFSDLRKISAVNVFPSNTSPFQRLLEEGAVPMDSVSPTLRHCSKLFIYLYKVATDSF
DSRTEQIPPCLTSESSLPSPWGTPALSRKRHAFHCVSTPPVYPAKSVTDLKLQVTSSPLP
SSEAVIIHPGAMLAMLDLLASVGSVTQPEHALDLQLAVANILQSLVHTERNQQVMCEAGL
HARLLQRCGAALADEDHSLHPPLQRMFERLASQALEPMVLREFLRLASPLNCGAWDKKLL
KQYRVHKPSSLSFEPDMRSSVVTSLEGLGSDSVFSSHEDNHYRISKSLVKSAEGSTVPLT
RVKCLVSMTTPHDIRLHGSSVTPAFVEFDTSLEGFGCLFLPSLAPHNAPTNNAVTTGLTD
GAVVSGIGSGERFFPPPSGLSYSCWFCIEHFSSPPNNHPVRLLTVVRRANSSEQHYVCLA
IVLSAKDRSLIVSTKEELLQNYVDDFSEESSFYEILPCCARFRCGELVVEGQWHHLALLM
SRGMLKNSTAALYIDGQLVSTVKLHYVHSTPGGSGSANPPVLSTVYAYIGTPPAQRQMAS
LVWRLGPTHFLEEVLPPSSVTAIYELGPDYVGSFQAVLVPCKDSKSEGIIPSPVSLVAEE
KVSFGLYALSVSSLTVARIRKVYNKLDSKAIAKQLGISSHENATPVKLVHNAAGHLNGPA
RTIGAALIGYLGVRTFVPKPVATTLQYIGGAAAILGLVAMASDVEGLYAAVKALVCVVKS
NPLASKEMERIKGYQLLAMLLKKRRSLLNSHILHLTFSLVGTVDSGHETSIIPNSTAFQD
LLCDFEVWLHAPYELHLSLFEHFIELLTESSEASKNAKLMREFQLIPKLLLTLRDMSLSQ
PTIAAMSNVLSHLLQGFPNSNDLLRFGQFISSTLPTFAVCEKFVVMEIINEGKPDSGAEE
EFGGLVSANLILLRNRLLDILLKLVYTSKEKTNINLQACEELVRTLGFDWIMMFMEEHLH
PTTVTAAMRILVVLLSNQSILIKFKEGLSGGGWLEQTDSVLTNKIGTVLGFNVGRSAGGR
STVREINRDACHFPGFLVLQSFLPKHTNVPALYFLLMALFLQQPVSELPENLQVSVPVTN
SRCKQGCQFDLDSIWTFIFGVPASSGTVVSSIHNVCTESAFLLLGMLRSMLNSPWQSEEE
GSWLREYPVTLMQFFRYLYHNVPDLASMWLSPDFLCALAATVFPFNIRPYSEMVTDLDDE
VGSPAEEFKAFAADTGMNRSQSEYCNVGTKTYLTNHPAKKFVFDFMRVLIIDNLCLTPAS
KQTPLIDLLLEASPERSTRTQQKEFQTHILDSVMDHLLAADVLLGEDASLPITSGGSYQV
LVNNVFYFTQRVVDKLWQGMFNKESKLLIDFIIQLIAQSKRRSQGLSLDAVYHCLNRTIL
YQFSRAHKTVPQQVALLDSLRVLTVNRNLILGPGNHDQEFISCLAHCLINLHAGSVEGFG
LEAEARMTTWHIMIPSDIEPDGGYSQDISEGRQLLIKAVNRVWTELIHSKKQVLEEVFKV
SLPVNDRGHVDIAVARPLIEEAGLKGWQNHLAHEKKCISRGEALVPTTQSKLSRVSSGFG
LSKLTGSRRNRKESGLHKHSPSPQEISQWMFTHIAVVRDLVDTQYKEYQERQQNALKYVT
EEWCQIECELLRERGLWGPPIGSHLDKWMLEMTEGPCRMRKKMVRNDMFYNHYPYVPETE
QEASVGKPARYRRAISYDSKEYYLRLASGNPTIVQDAIVESSEGEATQQEPEHGEDTIAK
VKGLVKPPLKRSRSAPDGGDEETQEQLQDQIAESGSIEEEEKTDNATLLRLLEEGEKIQH
MYRCARVQGLDTSEGLLLFGKEHFYVIDGFTMTATREIRDIETLPPNMHEPIIPRGARQG
PSQLKRTCSIFAYEDIKEVHKRRYLLQPIAVEVFSGDGRNYLLAFQKGIRNKVYQRFLAV
VPSLTDSSESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRWERGEISNFQYLMHLNTLAGR
SYNDLMQYPVFPWILADYDSEEVDLTNPKTFRNLAKPMGAQTDERLAQYKKRYKDWEDPN
GETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHFDLADRMFHSVREAWYSASKH
NMADVKELIPEFFYLPEFLFNSNNFDLGCKQNGTKLGDVILPPWAKGDPREFIRVHREAL
ECDYVSAHLHEWIDLIFGYKQQGPAAVEAVNVFHHLFYEGQVDIYNINDPLKETATIGFI
NNFGQIPKQLFKKPHPPKRVRSRLNGENAGLLCPEATSDKIFFHHLDNLRPSLTPVKELK
EPVGQIVCTDKGILAVEQNKVLIPPAWNKTFAWGYADLSCRLGTYESDKAVAVYECLSEW
GQILCAVCPSPKLVITGGTSTVVCVWEMGTSKEKAKPLTLKQALLGHTDTVTCATASIAY
HIIVSGSRDRTCIIWDLNKLSFLTQLRGHRAPVSALCINELTGDIVSCAGTYVHVWSING
NPIVSVNTFTGRSQQIVCCCMSEMNEWDTQNVIVTGHSDGVVRFWRMEFLQVPETPAPEP
VEDLEMQEGCPEAQIGQQAQDEDSSDSEAEEPSVSQDPKDTPSQPSSTSHRPRAASCRAT
ATWCTDSGSDDSRRWSDQLSLDEKDGFIFVNYSEGQARAHPQGSHSHPNPTEARSYSRLK
PGYRWERQLVFRSKLTMHTAFDRKDNTHPAEVTALGVSKDHSRILVGDSRGRVFSWSVSD
QPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKRLKISS
PVRVCQNCYYSLQHERGADDGPRNC
Download sequence
Identical sequences ENSRNOP00000035517 10116.ENSRNOP00000035517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]