SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000036408 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000036408
Domain Number 1 Region: 190-258
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.55e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 2 Region: 547-596
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000137
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 118-168
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000657
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000036408
Sequence length 601
Comment (Rattus norvegicus)
Sequence
MPSSLFADLERNGSGGGGGGGGGGGGSGSGGGETLDDQRALQLALDQLSLLGLDSDEGAS
LYDSEPRKKSVNMTECVPVPSSEHVAEIVGRQGGSRRDGDPRALSLSPTPSLEPWLPGCK
IKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVAMARREIISAAEHFSMIRASRNKNTALN
GAVPGPPNLPGQTTIQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPVFEVT
GMPENVDRAREEIEAHIALRTGGIIELTDENDFHANGTDVGFDLHHGSGGSGPGSLWSKP
TPSITPTPGRKPFSSYRNDSSSSLGSASTDSYFGGGTSGSTAATSRLADYSPPSPALSFA
HNGNNNNNGNGYTYTAGEASVPSPDGGTELQPTFDPAPAPPPGTPLLWAQFERSPGGGSA
APVSSSCSSSASSSASSSSVVFPGGGASSTPSNANLGLLVHRRLHPGTSCPRLSPPLHMA
TGAGEHHLARRVRSDPGGGGLAYAAYANGLGTQLPGLPSSDTSGSSSSSSSSSSSSSSSS
GLRRKGSRDCSVCFESEVIAALVPCGHNLFCMECANRICEKSEPECPVCHTAVTQAIRIF
S
Download sequence
Identical sequences 10116.ENSRNOP00000036408 ENSRNOP00000036408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]