SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000037018 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000037018
Domain Number 1 Region: 464-678
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-30
Family Laminin G-like module 0.0076
Further Details:      
 
Domain Number 2 Region: 913-1114
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.93e-27
Family Laminin G-like module 0.0081
Further Details:      
 
Domain Number 3 Region: 690-891
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-24
Family Laminin G-like module 0.025
Further Details:      
 
Domain Number 4 Region: 149-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000839
Family EGF-type module 0.004
Further Details:      
 
Domain Number 5 Region: 1143-1184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000127
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 6 Region: 1299-1339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000288
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 7 Region: 187-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000237
Family EGF-type module 0.006
Further Details:      
 
Domain Number 8 Region: 73-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000584
Family EGF-type module 0.027
Further Details:      
 
Domain Number 9 Region: 112-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000165
Family EGF-type module 0.018
Further Details:      
 
Domain Number 10 Region: 1139-1253
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000204
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 11 Region: 380-483
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000549
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 12 Region: 1266-1303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000882
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000037018
Domain Number - Region: 887-918
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0293
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 321-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0559
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 926-962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.059
Family EGF-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000037018
Sequence length 1408
Comment (Rattus norvegicus)
Sequence
MWKNLAEVSFALSLSLSLSLSLCVSNSFCNKNNTRCLSNSCQNNSTCKRFPQDSSCCLDT
ANDLDTDCEDLKDPCLSSPCQGTATCVNIPGERSFLCQCPPGYSGLTCDTATNSCGGNLC
QHGGTCHKDPEHPVCICPPGYAGRFCETDHNECDSSPCHNGAVCQDRINGYSCFCVPGYQ
GRHCDLEVDECVSDPCMNEAVCLNEIGRYTCVCPQEYSGNNLSIXLXXGXSQICLYNGSH
XDALXXDFCDSSLFLLGQGCGLNFKAIPRHTVLHCEPCFNLSENFFCDGYFKGNRGISAS
ASVPLCFLKGCPEGLQNQDHLGDSYTTNCSAGYTGALCETDINECSSNPCQFGGECAELS
SQDLYGNTAGLPSSFSYLGASGYVCICLPGFTGRHCEEDIDECLPNPCLNGGTCQNLPGN
YTCHCPFDDTSRTFYGGEDCSEILLGCTHHQCLNNGKCIPHFQNGQHEFTCQCPSGYAGP
LCETVTTLSFESNGFLWVTSGSHTSMGSECNISLKFQTVQPNALLLVRGNKDMSVKLELL
DGCVHLSIEVWNQSKVLLYISHNTSDGEWHLVEVTFAETITLALNGSSCKEKCTTKSSVS
IENHQSICALQNSFLGGLPMGTASDSMSVLNIYNVPSTPSFVGCLQDIRFDLNHITLESI
SSGLSSNVKAGCLRKDWCESQPCQNRGRCINLWQGYRCECDRPYAGSNCLKEYVAGRFGQ
DDSTGYAAFKVNDNFGQNFNLSMFVRTRQPLGFLLTLGNSTYQYVCVWLEHGSLALKTPG
SPKLVANFFLSDGNAHLISLRIKPNEIELYQSSQNLGFMSVPAWTIQRGDVIFIGGLPDR
EKTEAYGGFLKGCIQDVRLNSQNLEFFPNSTNSAQHDPVLVNVTQGCPGDNVCKSNPCHN
GGVCHSLWDDFSCSCPTNTSGRACDEVQWCQLSPCPPIAECQLVPQGFECIANAAFSGLS
SEILFRSNGNITRELTNITFGFRTQDTNAVILHAEKEPEFLNISIQDSRLLFQLRSGNSF
YTLHLTGSQLVNDGAWHRVTFSMIDPRAQTSLWQMEVDDQTPFVISAVATGNLNFLKDNT
DIYVGDQAVDNQKGLQGCLSTVQIGGLYLSYFESLHGFTSKPQEEQFLKVSTNVALTGCL
PLSACHSSPCLHGGICEDSYSSYRCACLPGWSGAHCEINVDECSSSPCVHGNCSDGVAAY
HCRCEPGYTGGNCEAEVDTCKSHQCANGATCVSGAQGYSCLCLGNFTGRFCRHSRLPSTV
CGNEKTNFTCYNGGSCSVFQEDWKCVCRPGFTGEWCEENINECASDPCINGGLCRDLVNR
FQCICDVAFAGERCELDLADDRLVGIITAVGSGTLVLLFILLLAAIVSLIASNKRATQGT
YSPSGQEKAGPRVEMWSRMPPPALERLI
Download sequence
Identical sequences ENSRNOP00000037018 10116.ENSRNOP00000037018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]