SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000037353 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000037353
Domain Number 1 Region: 17-163,208-315
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.9e-40
Family Calponin-homology domain, CH-domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000037353
Sequence length 331
Comment (Rattus norvegicus)
Sequence
MESEFLYDLLQLPKEVAQPTEEELPRGGKKRYLSPNSKRNPKFEQLQKVLMEWINATLLP
EHIVVRSLEEDMFDGLILHHLFQKLSSLKLEVEEISLTSASQRRKLGVILEAVNQSLQVE
EQQAKWSVETIFNKDLLATLHLLVALAKRFQPDLPLPDNIQVEVIHIESTKMGLKSDKQV
EQLTECNSHKDQPSQDAFDELFRLAPEKVHAVKEAIVSFVNQKLEGLGLSVQSLDTQFAD
GVILLLLIGQLEGFFLHLKEFYLTPSSPTEMLHNVTLALELLKDEGLCSYPINPEDIVNK
DTKSTLRILYGLFQKHSLRAVGDRAHHGTPK
Download sequence
Identical sequences D3ZWK2
ENSRNOP00000037353 10116.ENSRNOP00000037353 ENSRNOP00000037353 NP_001124055.1.100692 NP_001124055.1.4139 XP_006241473.1.100692 XP_006241474.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]