SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000037685 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000037685
Domain Number 1 Region: 8-83
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000037685
Sequence length 107
Comment (Rattus norvegicus)
Sequence
MDTGVTEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPKRIIT
LAGPTNAIFKAFAMIIDKLEEDISSSMTNSTAARRPPVTSRLVVPAS
Download sequence
Identical sequences 10116.ENSRNOP00000037685 ENSRNOP00000037685 XP_017459237.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]