SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000038320 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000038320
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily POZ domain 2.36e-32
Family Tetramerization domain of potassium channels 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000038320
Sequence length 260
Comment (Rattus norvegicus)
Sequence
MSDPITLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKRDSQGNCFIDRDGKVFRYIL
NFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKEIELSKAEKNAMLNITLKQHV
QTVHFTVREAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQD
PNHLTLDWVANVEGLPEEEYTKQNLKRLWVVPANKQINSFQAFVEEVLKIALSDGFCIDS
SHPHALDFMNNKIIRLIRYR
Download sequence
Identical sequences ENSRNOP00000038320 10116.ENSRNOP00000038320 ENSRNOP00000038320 NP_001102621.1.100692 NP_001102621.1.4139 XP_006229843.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]