SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000040240 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000040240
Domain Number 1 Region: 238-418
Classification Level Classification E-value
Superfamily MIR domain 1.01e-47
Family MIR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1097-1188
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-18
Family SPRY domain 0.043
Further Details:      
 
Domain Number 3 Region: 3921-3999
Classification Level Classification E-value
Superfamily EF-hand 0.00000000499
Family Calmodulin-like 0.029
Further Details:      
 
Domain Number 4 Region: 1346-1473
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000673
Family SPRY domain 0.017
Further Details:      
 
Domain Number 5 Region: 451-567
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000000085
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 
Domain Number 6 Region: 677-809
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000491
Family SPRY domain 0.068
Further Details:      
 
Domain Number 7 Region: 122-203
Classification Level Classification E-value
Superfamily MIR domain 0.0000112
Family MIR domain 0.021
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000040240
Domain Number - Region: 3011-3080,3142-3322,3565-3613,3640-3689,3746-3770,3847-3920,3964-3984,4072-4090,4122-4150
Classification Level Classification E-value
Superfamily ARM repeat 0.000173
Family Armadillo repeat 0.042
Further Details:      
 
Domain Number - Region: 524-639,1581-1629,1810-1840,1900-1940,2429-2530,2994-3158,3655-3707,3741-3773
Classification Level Classification E-value
Superfamily ARM repeat 0.0357
Family Armadillo repeat 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000040240
Sequence length 4885
Comment (Rattus norvegicus)
Sequence
ILMKASISFHESIRHKDHLLHYRLFNFCDLCFPMQEDEVVLQCIANIHKEQRKFCLAAEG
LGNRLCFLEPTSEAKYIPPDLCVCNFVLEQSLSVRALQEMLANTVENGGEGAAQGGSHRT
LLYGHAILLRHSFSGMYLTCLTTSRSQTDKLAFDVGLREHATGEACWWTIHPASKQRSEG
EKVRIGDDLILVSVSSERYLHLSISNGSIQVDASFMQTLWNVHPTCSGSSIEEGYLLGGH
VVRLFHGHDECLTIPSTDQNDSQHRRVFYEAGGAGTRARSLWRVEPLRISWSGSNIRWGQ
ALRLRHLTTGHYLALTEDQGLLLQDRGKADTKSTAFSFRASKEIKEKLDSSHKRDMEGMG
VPEIKYGDSVCFVQHVASGLWVTYKAQDAKTSRLGPLKRKVILHQEGHMDDGLTLQRCQQ
EESQAARIIRNTTALFSQFVSGNNRTAAPVALPIEEVLQTLQDLIAYFQPPEEDMQHEDK
QNKLRSLKNRQNLFKEEGMLALVLNCIDRLNIYNSVAHFAGIIREENGMAWKEILNLLYK
LLAALIRGNRNNCAQFSNNLDWLISKLDRLESSSGILEVLHCILIESPEALNLIAEGHIK
SIISLLDKHGRNHKVLDVLCSLCLCNGVAVRANQNLICDNLLPRRNLLLQTRLINDVTSI
RPNIFLGVAEGSPQYKKWYFELIIDQVEPFLTAEPTHLRVGWASSSGYAPYPGGGEGWGG
NGVGDDLYSYGFDGLHLWSGRIPRAVASINQHLLKSDDVVSCCLDLGVPSISFRINGQPV
QGMFENFNTDGLFFPVMSFSAGVNLIFLLGQGCGQGKFLASSLHVPCISSLLPQERKKER
KKERKKERKKERKILLCSQFYSNAVTVPTPVKSYQVVLPLHLEKIRDRLAENIHELWGMN
KIELGWTFGKVRDDNKRQHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHVNPA
AEEDLKKVKLPKNYMMSNGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGW
TYGIQQDLKNKRNPRLVPYALLDERTKKSNRDSLREAVRTFVGYGYNIEPSDQELVADPT
VEKVSIDKIRFFRVERSYAVKSGKWYFEFEVVTGGDMRVGWARPGCRPDIELGADDQAFV
FEGSRGQRWHQGSGYFGRTWQPGDVVGCMINLDDASMVFTLNGELLITNKGSELAFADYE
IENGFVPICSLGLSQIGRMNLGTDASTFKFYTMCGLQEGFEPFAVNMNRDVAVWFSKRLP
TFVNVPKDHPHIEVVRIDGTMDSPPCLKVTHKTFGTQNSNANMIYCRLSMPVECHSSFSH
SPCLDSEAFQKRKQMQEILSHTTTQCYYAIRIFAGQDPSCVWVGWVTPDYHLYSEKFDLN
KNCTVTVTLGDERGRVHESVKRSNCYMVWGGDIVASSQRSSRSNVDLEIGCLLDLAMGML
SFSANGKELGTCYQVEPNTKVFPAVFLQPTSTSLFQFELGKLKNAMPLSAAIFKSEEKNP
IPQCPPRLDVQTIQPVLWSRMPSSFLKVETERVSERHWVVQCLQPLQMMALHIPEENRCV
DILELCEQEDLMQFHYHTLRLYSAVCALGNSRVASALCSHVDLSQLFYAIDNKYLPGLLR
SGFYDLLISIHLANAKERKLMMKNEYIIPITSSTRNIRLYPDESKRHGLPGVGLRTCLKP
GFRFSTPCFVVTNEDHQKQSPEIPLQILKTKALSMLTEAVHCSGAHIRDPVGGSVEFQFV
PVLKLIGTLLVMGVFDDDDVRQILLLIDPSVFGEHSGETEEGVEKEVTHVEEKAVEAGEK
ASKEAPVKGLLQTRLPESVKLQMCELLSYLCDCELQHRVEAIVAFGDIYVSKLQANQKFR
YNELMQALNMSAALTARKTREFRSPPQEQINMLLNFHLGENCPCPEEIREELYDFHEDLL
VHCGVPLEEEEEEEEDTSWTGKLCALVYKIKGQPKPEKEPPTEEEEPYPTTLKELVSQTM
IRWAQENQIQDAELVRMMFNLLRRQYDSIGELLQALRKTYTISQASVNDTINLLAALGQI
RSLLSVRMGREEELLMINGLGDFGGLRMYYKQKKASQCLGLYSDPFHTGENFLIVEMTKL
VYPGLIKGCCFLVCGFRRLQKNSQRGMRIHCLLFLPNSIRRLKELGLRNGYPLDVSCLTS
HDNIVIYWGLEFPCMKKVVTYLAGCGLQSCPMLLAKGYPDIGWNPIEGERYLSFLRFAVF
VNSESVEENASVVVKLLIRRPECFGPALRGEGGNGLLAAMQGAIKISESPALDLPSQGYK
TEVTQDDEEEEEIVHMGNAIMSFYSALIDLLGRCAPEMHLIQTGKGEAIRIRSILRSLVP
TEDLVGIISIPLKLPSLNKDGSVSEPDMAANFCPDHKAPMVLFLDRVYGIKDQTFLLHLL
EVGFLPDLRASASLDTVSLSTTEAALALNRYLCSAVLPLLTRCAPLFSGTEHCTSLIDST
LQTIYRLSKGRSLTKAQRDTIEECLLAICNHLRPSMLQQLLRRLVFDVPQLSEYCKMPLK
LLTNHYEQCWKYYCLPSGWGSYGLAVEEELHLTEKLFWGIFDSLSHKKYDPDLFRMALPC
LSAIAGALPPDYLDTRITATLEKQVSVDADGNFDPKPINTMNFSLPEKLEYIVTKYAEHS
HDKWACDKSHSGWKYGISLDENVKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWT
VERTKEGEALVQQRENEKLRCVSQSNQGNSYSPAPLDLSNVVLSRELQGMVEVVAENYHN
IWAKKKKLELESKGGGSHPLLVPYDTLTAKEKLRDREKAQDLFKFLQVNGILVSRGVKDM
ELDASSMEKRFAYKFLRKILKYVDSAQEFIAHLEAIVSSGKTEKSPHDQEIKFFAKVLLP
LVDQYFTNHRLYFLSSPLKPLSSSGYASHKEKEMVASLFCKLAALVRHRISLFGSDSTTM
VSCLHILAQTLDTRTVMKSGSELVKAGLRAFFENAAEDLEKTSENLKLGKFTHSRTQIKG
VSQNINYTTVALLPILTSIFEHIAQHQFGVDLLLSDVQISCYHILCSLYSLGTGKNIYVE
RQRPALGECLASLAAAIPVAFLEPSLNRYNPLSVFNTKTPRERSILGMPDKVEDMCPDVP
QLEGLMKEINGLAESGARYTEMPHVIEVILPMLCNYLSYWWERGPENLPPSIGPCCTKVT
SEHLSLILGNILKIINNNLGIDEASWMKRIAVYAQPIISKARPDLLRSHFIPTLEKLKKK
AVKIVQEEEQLKTDGKGDTQEAELLILDEFAVLCRDLYAFYPMLIRYVDNNRSNWLKSPD
TDSDQLFRMVAEVFILWCKSHNFKREEQNFVIQNEINNLAFLTGDSKSKMSKAMQVKSGG
QDQERKKTKRRGDLYSIQTSLIVAALKKMLPIGLNMCTPGDQELISLAKSRYSCRDTDEE
VKEHLRNNLHLQEKSDDPAVKWQLNLYKDVLRNEEPSNPEKTVERVQRISAALFHLEQVE
QPLRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRSINLFLHGYQRFWIETEAYSFE
EKLVQDLAKSPRVEDEEEEETEKQPDPLHQIILHFSRNALTERSKLEDDPLYTSYSSMMA
KSCQSGEDEEEEEDKEKTFEEKEMEKQKTLYQQARLHERGAAEMVLQMISASKGEMSPMV
VETLKLGIAILNGGNAGVQQKMLDYLKEKKDAGFFQSLSGLMQSCRSVLDLNAFERQNKA
EGLGMVTEEGTLIVRERGEKVLQNDEFTQDLFRFLQLLCEGHNSDFQNFLRTQMGNTTTV
NIIISTVDYLLRLQESISDFYWYYSGKDIIDESGQHNFSKALAVTKQIFNSLTEYIQGPC
IGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQDSSQIELLKELLDLLQDMVVMLLSLLEG
NVVNGTIGKQMVDTLVESSTNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGIISRKEF
QKAMEGLKQYTQSEIDFLLSCTEADENDMFNYVDFVERFHEPAKDIGFNVAVLLTNLSEH
MPNDSRLKCLLDPAESVLNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKES
KRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLASQISESDSTDRPEEEEEEDEDSYSV
EIEGEEEDKSFESASAFAMACASAKRNVTKFLKKATLKNLRKQYRNVKKMSAKELVRVLS
SFFWMLVVGLFQLLFSILGGIFHILWNTVFGGGLVEGAKNIRVTKILGDMPDPTQFGIHD
DVMEIDRAEVTEPGITTELVHFVKGEAGDTDVMSDLFGIHSKKEGGSKQGPEVGLGDLSE
ITGKDEPPTLESTVRKKRKAQAAEMKAVHEAEGRTESEKADMEDREKEDKIKEEGQAEYL
WADTTVKKTRRRGQKAEKPVAFMANFFKGLEIYQTKLLHYLARNFYNLRFLALFVAFAIN
FILLFYKVTEEPLEEETEDVANLWNSFNEDDEEEAMVFFVLQESTGYMAPTLRALAIVHT
VISLVCVVGYYCLKVPLVVFKREKEIARKLEFDGLYITEQPSEDDIKGQWDRLVINTPSF
PNNYWDKFVKRKVINKYGDLYGAERIAELLGLDKNALDFSPVEEAKAEAASLVSWLSSID
MKYHIWKLGVVFTDNSFLYLAWYTTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTH
NGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDDDEPDMKCDDMMTCYLFHMYVGVR
AGGGIGDEIEDPAGDPYEMYRIVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVRE
DMETKCFICGIGNDYFDTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWK
MYQERCWDFFPAGDCFRKQYEDQLG
Download sequence
Identical sequences 10116.ENSRNOP00000040240 ENSRNOP00000027865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]