SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000040473 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000040473
Domain Number 1 Region: 484-689
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-38
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 701-892
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-37
Family Laminin G-like module 0.007
Further Details:      
 
Domain Number 3 Region: 896-1076
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.29e-37
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 4 Region: 274-467
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.08e-34
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 5 Region: 9-190
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.22e-32
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 6 Region: 1109-1202
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000106
Family Laminin G-like module 0.0000878
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000040473
Domain Number - Region: 224-255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00156
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000040473
Sequence length 1520
Comment (Rattus norvegicus)
Sequence
MGTALVQHGGCCLLCLSLLLLGCWAELGSGLEFPGAEGQWTRFPKWNACCESEMSFQLKT
RSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIR
RQFRNTTLYIDRAEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPF
KGWIRDVRVNSSQALPVDGSEVLDEEPPNSGGGSPCEAGDEGDGGVCLNGGVCSVVDDQA
VCDCSRTGFRGKDCSQGTSVQGIKRMKAGDNQTQSTECLAHLMMGDQGKEEYIATFKGSE
YFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGA
FEALVEPVNGKFNDNAWHDVKVTRNLRQHSGIGHAMVNKLHCSVTISVDGILTTTGYTQE
DYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKM
KIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGK
PRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRD
GRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGC
IRDLFIDGQSKDIRQMAEIQSTAGVKPSCSRETAKPCLSNPCKNNGMCRDGWNRYVCDCS
GTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDS
ADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKL
TVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLC
KNGDIDYCELNARFGFRNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLIL
YNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTV
KIDTKITTQITAGARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLP
DLISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPG
TTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIV
KNLGNNEKVKPKDISIEETKLSIIIDGEAKIFHDKTKFGNYTLEKARNSVVEHLPSNGVL
DNSHVFLKLVGIPIRMERPVLEDKARLHCIFNNSQHAVVDSFPKKSYSQSQFGGLLLALT
SVLGMLWIRSGNICILVILLLQLPVPASLVKAWSRLSQRSNPSQSIKEDKTTAFLFSHSS
TRPPLSESMTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRVGGREPYPGSAEVIRES
SSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNSAQSNGAVVKEKQ
PSSAKSANKNKKNKDKEYYV
Download sequence
Identical sequences ENSRNOP00000047615 10116.ENSRNOP00000040473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]