SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000042417 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000042417
Domain Number 1 Region: 57-281
Classification Level Classification E-value
Superfamily L domain-like 3.74e-41
Family Ngr ectodomain-like 0.044
Further Details:      
 
Domain Number 2 Region: 639-754
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-29
Family Calponin-homology domain, CH-domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000042417
Sequence length 769
Comment (Rattus norvegicus)
Sequence
MAAAGLVAVVAAAEYSGPVGSGGNLSGANCGPSPGLGPGSWSRSVDRALEEAAVTGVLSL
SGRKLREFPRGAANHDLTDTTRADLSRNRLSEIPMETCHFVSLESLNLYQNCIRYIPEAV
LNLQALTFLNISRNQLSTLPVHLCNLPLKVLIASNNKLVSLPEEIGQLRHLTELDVSCNE
IQTVPSQIGNLEALRDFNVRRNHLLRLPEELAEVPLIRLDFSCNKITVIPVCYRNLRHLQ
VITLDNNPLQSPPAQICIKGKIHIFKYLNIQACKIAPDLPDYERRPLGFGSCHEELYSGR
PYGALDSGFNSVDSGDKRWSGNEPTDEFSDLPLRVAEITKEQRLRRESQYQENRSSVVVT
NGGVDHDLDQIDYIDSCTTEEEENDVKRPKSLDTSSLSSQFLAYIEQRRISHEGSPVKPI
AVRDFQKTEDMKRYSHQNRVPVEPSLVLSVPPSHNQLSHSDLELHQRGEQSVERARREAQ
LAALQYEGEKIRTKQIQRDAGLDFVKHKVSQNPQKQQPPGNGECPFPSRRSQHTDDSALL
VSLSGLDGVSCVATRPHSSAFTPLKSNDRVDVTSSFPMTDTARHSPAYSFPAATQRNQPQ
RPESFLFRATVRAEASKGRASPLLSSAPATDAADSIARQREEELRLIDQLRKHIEYRLKV
SLPCDLGAALTDGVVLCHLANHVRPRSVPSIHVPSPAVPKLTMAKCRRNVENFLDACRKI
GVPQEQLCLPLHILEEKGLGQVAVTVQALLELAPPKQQPQQQPPQLSAV
Download sequence
Identical sequences XP_003752547.1.4139 ENSRNOP00000063876 10116.ENSRNOP00000042417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]