SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000044412 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000044412
Domain Number 1 Region: 39-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.22e-41
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00094
Further Details:      
 
Domain Number 2 Region: 168-362
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-36
Family Laminin G-like module 0.0065
Further Details:      
 
Domain Number 3 Region: 722-748,783-936
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.43e-35
Family Laminin G-like module 0.0025
Further Details:      
 
Domain Number 4 Region: 352-519
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.46e-35
Family Laminin G-like module 0.0049
Further Details:      
 
Domain Number 5 Region: 966-1170
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.36e-28
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 6 Region: 576-635
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000000785
Family Fibrinogen C-terminal domain-like 0.0055
Further Details:      
 
Domain Number 7 Region: 548-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000495
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000044412
Sequence length 1305
Comment (Rattus norvegicus)
Sequence
MDSLQRLNGLLTLVLSALWHLGLTASNYNCDDPLASFFSPMTFSSSLDLTGSYSSAQLNW
KMGTGGWSPVDSNAQQWLQIDLGNRVEITAVATQGRYGSSDWVTSYRLMFSDTGHNWQHY
TQEDSIWTFVGNMNADSVVHHRLLHSMRARFVRFVPLEWNPNGKIGMRVEAYGCSYRSDV
ADFDGRSTLLYRFNQKTMSTLKDVISLKFKSMQGDGVLFHGEGQRGDHVTLELQKGRLAL
YLNLDDSKARLSSTVPLVIMGSLLDDQHWHSVLLERVGKQANFTVDMNTQHFQTKGETDA
LDIDYELSFGGIPVPSKPGTFVKKNFHGCMENLYYNGVNIIDLAKRRKHQIYSGNVTFSC
SEPQIVPITFVNSRSSYLMLPGTPQIDGLSVSFQFRTWNEDGLLLSTELSEGSGTLLLIL
EGGTLRLLIKKVAGHGTEIKTGSGLNDGLWHSVSINARRNRVTLTLDNDAASPAPETSRK
QIYSGKSYYFGGCPDNLTDSQCLNPIKAFQGCMRLIFIDNQPKDLISVQQGSLGNFSDLH
IDLCSIKDRCLPNYCEHGGHCAQTWTTFYCNCSDTGYTGATCHDSIYEQSCEVYRHKGHT
AGFFYVDSDGSGPLGPLQVYCNITEDKIWMTVQHNNTELTRVQGSSPEKPYSMTLNYGGS
MEQLEALIDGSEYCEQELKYHCRRSRLLNTLDGTPFTWWIGRSNERHPYWEGSVPGVQQC
GCGLEESCLDNAYFCNCDADMDEWSNNTGLFSLKDHLPVTHVIITDTNRSNSEAAWRIGP
LRCNGDRHFWNAVSFSTEASYLHFPTFHAEFSADISFFFKTTALSGVFLENLGIKDFLRL
EMSSPSEVTFTIDVGNGPVELLVQSPYPLNDNQWHYIRAERNVKETSLQVDNLPLSLREA
SEEAYFRLHLTSQLFVGGTSSRQKGFLGCMRSLHLNGQNTDLIERAKLMSGVTPGCPGHC
SSYSSNCHNGGKCVEKQSGYSCDCTNSPNEGPFCQKEISALFDPGTSVTYMFQEPYLVIK
NTSLLSSPIYTDTARSKETIMLNFLTAQAPTILLYLNFSSQKFLAILLSSNGDLQIRFRL
SKGESHVYTMSTENLANGRVHQVKISKDGPEISIQMDQQLFSYNFSTKVEFWTLKSLVLG
KVTETLGLDPEVAKVNILGFLGCLSSVQYNHIAPLKAALRHAGVAPVTVHGTLTESGCDS
TLDSDVNAVTTVHSSLEPIGKRDEQEPLTNTVQSDSAVIGGIIAVVTFVTFCVIGIMICF
LYQHKQSHRTNQTKEKEYPETLSNSFRNVIDLQNTASECKREYFI
Download sequence
Identical sequences ENSRNOP00000044394 10116.ENSRNOP00000044412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]