SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000045051 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000045051
Domain Number 1 Region: 4-81
Classification Level Classification E-value
Superfamily HMG-box 2.88e-19
Family HMG-box 0.0000101
Further Details:      
 
Domain Number 2 Region: 76-151
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000209
Family HMG-box 0.0000492
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000045051
Sequence length 210
Comment (Rattus norvegicus)
Sequence
TGIGDPKKPRGKMSSNAFFVQTCQEHKKKHPDAFNFSEFSEKCSERWKTMFAKEKGKFED
MAKADKARYEREMKTYIPPKGETKEKFKNPNALKGPPPAFLFCSEYHPKTKGEHPGLSIG
DVEKKLGEMWTNTADDKQPCGKKAAKLKEYEKDITACRAEGKPDVGKMGVVKVEKSKEKK
EEEDDEEDEEREEEKKKERKEERKKERKKE
Download sequence
Identical sequences ENSRNOP00000045113 10116.ENSRNOP00000045051 ENSRNOP00000045051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]