SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000046390 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000046390
Domain Number 1 Region: 326-404
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.1e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000935
Further Details:      
 
Domain Number 2 Region: 82-167
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.36e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 3 Region: 49-92
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000135
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000046390
Domain Number - Region: 236-241
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00288
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000046390
Sequence length 410
Comment (Rattus norvegicus)
Sequence
METEQAEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELHILLQSKNGAVIGKG
GKNIKALRTDYNASVSVPDSSGPERILSISADIXLRLLIHQSLAGGIIGVKGAKIKELQE
NTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLLSESPIKGAQPYDPNFYDET
YDYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPGQGGRPMPPSRRDYDDMSPRRGPPPPP
PGRGGRGGSRARNLPLPPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTW
SPSEWQMAYEPQGGSGYDSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQI
RHESGASIKTDEPLEGSEDRIITITGTQDQIQNTQYLLQNSVKQYSGKFF
Download sequence
Identical sequences 10116.ENSRNOP00000046390 ENSRNOP00000046390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]