SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000047111 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000047111
Domain Number 1 Region: 299-366
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.34e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 2 Region: 210-275
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000108
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 3 Region: 635-687
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000253
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000047111
Sequence length 692
Comment (Rattus norvegicus)
Sequence
ALAGAEDAAPRPPPEPDDAAAALRLALDQLSALGLGDARPGDEGMATRSADGATERGEDE
PVPPDELEAAVAPPVTGAPSMGVGPSMAVAPSVTCAPSMALAPSVTSAASMAVAPSVTCA
PCMAVAPSVTVAPSMALTPSVTLAPTMAVASPVAPGGLPLLDPDVSPRPSPPDVFASFAP
HPAALGPSTLLAEQLNVIGSRKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTY
IKTPVRGEEPVFIVTGRKEDVEMAKREILSAAEHFSLIRATRSKAGGLSGATPGPPNLPG
QTTIQVRVPYRVVGLVVGPKGATIKRIQQRTHTYIVTPGRDKEPVFAVTGMPENVDRARE
EIEAHITLRTGAFTDAGPDSDFHANGTDVCLDLLGAAASLWAKAPHPGRRPPTATGGLRG
DNALGAASTPEPFYVGSRGGPALPDPSPSSPYGGSGNGGFTFGGDGPGAPTGTTTPEDCD
FGFDFLALDLTVPATATIWAPFERAAPLPAFSGCPTVNGAPAQPNTGTRRSSGGGGAATT
PRHSPTLPEPGGLSLELPLARRGVPDPVGAVPWRPPQSTLPPFSGSTTFSTTPSLPSTTP
ASSTMDTVPSEGNHKPSTTAANSSASAAAPGPPAAALARECVVCSEGEAMAALVPCGHNL
FCMDCAVRICGKSEPECPACRTPATQAIHIFS
Download sequence
Identical sequences ENSRNOP00000047111 10116.ENSRNOP00000047111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]