SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000047436 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000047436
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.15e-24
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000047436
Domain Number - Region: 62-134
Classification Level Classification E-value
Superfamily RAP domain-like 0.0225
Family RAP domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000047436
Sequence length 141
Comment (Rattus norvegicus)
Sequence
GLVSFEDVAVDFTLEEWQDLNAAQRTLYRDVMLENYRSLVFLGHCMNKPELIFKLEQGLG
PWNVAEASGRSLPDVHVLTEPIGTSQKSHKVCVWQGRTTQHKASSEKIAELKEQQKKVHR
GSKTCVREAHGKTFCQKSQCT
Download sequence
Identical sequences 10116.ENSRNOP00000047436 ENSRNOP00000047436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]