SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000048043 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000048043
Domain Number 1 Region: 6-133
Classification Level Classification E-value
Superfamily EF-hand 1.83e-44
Family p25-alpha 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000048043
Sequence length 170
Comment (Rattus norvegicus)
Sequence
MASEAEKTFHRFAVFGESSSSGNEITNKNFSKLCKDCGIMDGKAVTSTDVDIVFSKVKAK
NARTINFQQFQEAMKELGQKRFKGKNPDEALEDVFKLMEGKDPATTGATKATTVGGVDRL
TDTSKYTGTHKERFDESGKGKGIEGREETTDNSGYVSGYKGAGTYDKKSQ
Download sequence
Identical sequences D3ZCE7
10116.ENSRNOP00000048043 ENSRNOP00000048043 NP_001102570.1.100692 NP_001102570.1.4139 ENSRNOP00000048043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]