SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000049257 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000049257
Domain Number 1 Region: 20-117
Classification Level Classification E-value
Superfamily Immunoglobulin 1.05e-35
Family V set domains (antibody variable domain-like) 0.0000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000049257
Sequence length 118
Comment (Rattus norvegicus)
Sequence
MDRLTSSFLLLIVPAYVLSQVTLKESGPGILQPSQALSLTCTFSGFSLSTYGMRVSWIRQ
PSGKGLEWLATIDWDDDKYYNPSLKSRLTVSKDTSNNQAFLKITSMDSADTATYYCAW
Download sequence
Identical sequences ENSRNOP00000049257 10116.ENSRNOP00000049257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]