SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000050122 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000050122
Domain Number 1 Region: 10-126
Classification Level Classification E-value
Superfamily Immunoglobulin 3.21e-20
Family V set domains (antibody variable domain-like) 0.00017
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000050122
Domain Number - Region: 129-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000308
Family C2 set domains 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000050122
Sequence length 264
Comment (Rattus norvegicus)
Sequence
SLVQDLEFQLVAPKSVTVEEALCVHVPCSVSYPSIRPTFGPVTGYWLLKGTSLHEDSPVA
TNDPRQLVQKATQGRFQLLGDPQKHDCSLLIRDAQKNDTGVYFFRVVREPFVRYSYRANQ
LLLHVTPLSRTPDIIIPETLRAGHPSNLSCSVPWACEQGTPPIFCTESLVPCPIKAVTDY
TDTLTPEPTNSPILWTSGLGYCSNTATEKQVLRKSDQMRQVVLVAVGEAAVKLLILGLCL
TLLSPSSAHTSVLGFLSVVICRRK
Download sequence
Identical sequences NYSGRC-IgSF-ENSRNOP00000050122 10116.ENSRNOP00000050122 ENSRNOP00000050122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]