SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000050623 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000050623
Domain Number 1 Region: 1243-1450
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.05e-45
Family Laminin G-like module 0.00025
Further Details:      
 
Domain Number 2 Region: 1732-1958
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.94e-35
Family Laminin G-like module 0.000000999
Further Details:      
 
Domain Number 3 Region: 1501-1708
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-31
Family Laminin G-like module 0.00061
Further Details:      
 
Domain Number 4 Region: 363-430
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 1.52e-16
Family Ovomucoid domain III-like 0.0067
Further Details:      
 
Domain Number 5 Region: 67-137
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000735
Family Ovomucoid domain III-like 0.0054
Further Details:      
 
Domain Number 6 Region: 446-495
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000291
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 7 Region: 511-560
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000485
Family Ovomucoid domain III-like 0.0075
Further Details:      
 
Domain Number 8 Region: 796-865
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000527
Family Ovomucoid domain III-like 0.0099
Further Details:      
 
Domain Number 9 Region: 1041-1111
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000034
Family SEA domain 0.0031
Further Details:      
 
Domain Number 10 Region: 594-645
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000402
Family Ovomucoid domain III-like 0.0043
Further Details:      
 
Domain Number 11 Region: 293-357
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000393
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 12 Region: 688-731
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000017
Family Laminin-type module 0.0048
Further Details:      
 
Domain Number 13 Region: 143-213
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000194
Family Ovomucoid domain III-like 0.0068
Further Details:      
 
Domain Number 14 Region: 236-284
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000471
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number 15 Region: 1443-1478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000373
Family EGF-type module 0.045
Further Details:      
 
Domain Number 16 Region: 742-779
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000046
Family Laminin-type module 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000050623
Sequence length 1960
Comment (Rattus norvegicus)
Sequence
MPPLPLEHRPRQEPGASMLVRYFMIPCNICLILLATSTLGFAVLLFLSNYKPGIHFTPAP
PTPPDVCRGMLCGFGAVCEPSVEDPGRASCVCKKNACPATVAPVCGSDASTYSNECELQR
AQCNQQRRIRLLRQGPCGSRDPCANVTCSFGSTCVPSADGQTASCLCPTTCFGAPDGTVC
GSDGVDYPSECQLLSHACASQEHIFKKFNGPCDPCQGSMSDLNHICRVNPRTRHPEMLLR
PENCPAQHTPICGDDGVTYENDCVMSRIGATRGLLLQKVRSGQCQTRDQCPETCQFNSVC
LSRRGRPHCSCDRVTCDGSYRPVCAQDGHTYNNDCWRQQAECRQQRAIPPKHQGPCDQTP
SPCHGVQCAFGAVCTVKNGKAECECQRVCSGIYDPVCGSDGVTYGSVCELESMACTLGRE
IQVARRGPCDPCGQCRFGSLCEVETGRCVCPSECVESAQPVCGSDGHTYASECELHVHAC
THQISLYVASAGHCQTCGEKVCTFGAVCSAGQCVCPRCEHPPPGPVCGSDGVTYLSACEL
REAACQQQVQIEEAHAGPCEPAECGSGGSGSGEDDECEQELCRQRGGIWDEDSEDGPCVC
DFSCQSVPRSPVCGSDGVTYGTECDLKKARCESQQELYVAAQGACRGPTLAPLLPVAFPH
CAQTPYGCCQDNFTAAQGVGLAGCPSTCHCNPHGSYSGTCDPATGQCSCRPGVGGLRCDR
CEPGFWNFRGIVTDGHSGCTPCSCDPRGAVRDDCEQMTGLCSCRPGVAGPKCGQCPDGQV
LGHLGCEADPMTPVTCVEIHCEFGASCVEKAGFAQCICPTLTCPEANSTKVCGSDGVTYG
NECQLKAIACRQRLDISTQSLGPCQESVTPGASPTSASMTTPRHILSKTLPFPHNSLPLS
PGSTTHDWPTPLPISPHTTVSIPRSTAWPVLTVPPTAAASDVTSLATSIFSESGSANGSG
DEELSGDEEASGGGSGGLEPPVGSIVVTHGPPIERASCYNSPLGCCSDGKTPSLDSEGSN
CPATKAFQGVLELEGVEGQELFYTPEMADPKSELFGETARSIESTLDDLFRNSDVKKDFW
SVRLRELGPGKLVRAIVDVHFDPSKPLFPSREMMGPSSPQPQPSRHQALAVRRPLQEHVR
FLDFDWFPTFFTGAATGTTAAMATARATTVSRLPASSVTPRVYPSHTSRPVGRTTAPPTT
RRPPTTATNMDRPRTPGHQQPSKSCDSQPCLHGGTCQDQDSGKGFTCSCTAGRGGSVCEK
VQPPSMPAFKGHSFLAFPTLRAYHTLRLALEFRALETEGLLLYNGNARGKDFLALALLDG
RVQFRFDTGSGPAVLTSLVPVEPGRWHRLELSRHWRQGTLSVDGETPVVGESPSGTDGLN
LDTNLYVGGIPEEQVAMVLDRTSVGVGLKGCIRMLDINNQQLELSDWQRAAVQSSGVGEC
GDHPCLPNPCHGGALCQALEAGMFLCQCPPGRFGPTCADEKSPCQPNPCHGAAPCRVLSS
GGAKCECPLGRSGTFCQTVLETAGSRPFLADFNGFSYLELKGLHTFERDLGEKMALEMVF
LARGPSGLLLYNGQKTDGKGDFVSLALHNRHLEFCYDLGKGAAVIRSKEPIALGTWVRVF
LERNGRKGALQVGDGPRVLGESPKSRKVPHTMLNLKEPLYIGGAPDFSKLARGAAVSSGF
NGVIQLVSLRGHQLLTQEHVLRAVDVSPFADHPCTQALGNPCLNGGSCVPREATYECLCP
GGFSGLHCEKGLVEKSVGDLETLAFDGRTYIEYLNAVIESELTNEIPAPETLDSRALFSE
KALQSNHFELSLRTEATQGLVLWIGKAAERADYMALAIVDGHLQLSYDLGSQPVVLRSTV
KVNTNRWLRIRAHREHREGSLQVGNEAPVTGSSPLGATQLDTDGALWLGGLQKLPVGQAL
PKAYGTGFVGCLRDVVVGHRQLHLLEDAVTKPELRPCPTP
Download sequence
Identical sequences ENSRNOP00000060444 10116.ENSRNOP00000050623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]