SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000050637 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000050637
Domain Number 1 Region: 44-112
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 2 Region: 291-337
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000303
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000050637
Sequence length 343
Comment (Rattus norvegicus)
Sequence
MVTGRREDVATARREIISAAEHFSMIRASRNKSGAAFGVAPALPGQVTIRVRVPYRVVGL
VVGPKGATIKRIQQQTNTYIITPSRDRDPVFEITGAPGNVERAREEIETHIAVRTGKILE
YNSDGDFLAGSPDAALDSRYSDAWRVHAPGCKPLSTFRQNSLGCIGECGVDSAFEAPRLG
EQGGDFGYGGYLFPGYGVGKQDVYYGVAETSPPLWAGQENATPTSVLFSSASSSSSSAKA
RAGPPGAHRSPATSAGPEQLTGLPRRPPGEPLQGFSKLGAGGLRSPGGGRDCMVCFESEV
TAALVPCGHNLFCMECAVRICERTDPECPVCHITATQAIRIFS
Download sequence
Identical sequences 10116.ENSRNOP00000050637 ENSRNOP00000050637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]