SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000050794 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000050794
Domain Number 1 Region: 12-142,173-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.66e-77
Family Calponin-homology domain, CH-domain 0.0000332
Further Details:      
 
Domain Number 2 Region: 3339-3459
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-17
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 3 Region: 7189-7333
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-16
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 4 Region: 1691-1826
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-16
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 5 Region: 7642-7773
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-16
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 6 Region: 4577-4732
Classification Level Classification E-value
Superfamily Spectrin repeat 9.85e-16
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 7 Region: 6978-7118
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000207
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 8 Region: 1474-1606
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000368
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 9 Region: 2527-2681
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000129
Family Spectrin repeat 0.0081
Further Details:      
 
Domain Number 10 Region: 3185-3341
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000226
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 11 Region: 3955-4063
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000262
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 12 Region: 4357-4513
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000275
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 13 Region: 627-767
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000182
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 14 Region: 7316-7445
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000275
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 15 Region: 5123-5273
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000322
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 16 Region: 2746-2881
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000932
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 17 Region: 3829-3950
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000144
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 18 Region: 7565-7676
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000017
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 19 Region: 5820-5898,6057-6103
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000732
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 20 Region: 6065-6205
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000345
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 21 Region: 1158-1296
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000684
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 22 Region: 3635-3767
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000131
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 23 Region: 1780-1932
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000139
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 24 Region: 2895-3012
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000162
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 25 Region: 2118-2257
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000054
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 26 Region: 5548-5667
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000049
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 27 Region: 2315-2469
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000595
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 28 Region: 1612-1722
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000419
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 29 Region: 1995-2139
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000759
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 30 Region: 7769-7883
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000912
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 31 Region: 7943-8022
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000107
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 32 Region: 3528-3630
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000144
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 33 Region: 3456-3562
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000176
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 34 Region: 946-1083
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000338
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 35 Region: 3104-3211
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000564
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 36 Region: 5673-5764
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000144
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 37 Region: 4067-4201
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000312
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 38 Region: 6215-6330
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000368
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 39 Region: 5066-5131
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000162
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 40 Region: 5234-5354
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000023
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 41 Region: 4274-4401
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000314
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 42 Region: 6540-6645
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000694
Family Spectrin repeat 0.014
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000050794
Domain Number - Region: 6716-6791
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000168
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 4944-5050
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000736
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number - Region: 4771-4844
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00602
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 5366-5452
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00761
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number - Region: 6884-6972
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0827
Family Spectrin repeat 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000050794
Sequence length 8026
Comment (Rattus norvegicus)
Sequence
MATSRASSRSHRDITNVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDG
IKLLALLEVLSGQKLPCEQGHRGKRIHAVANIGTALKFLEGRKIKLVNINATDIADGRPS
IVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSMVSTETASPPSKRKVATKVQGNA
KKTLLKWVQHTAGKQMGIEVKDFGKSWRTGLAFHSVIHAIRPELVDLEKVKNRSNRENLE
DAFTIAETQLGIPRLLDPEDVDVDKPDEKSIMTYVAQFLTQYPDIRGAGYDVQENDVGEM
LSANIPAALFSDGLSLPLLSSGGCRRASKAVISKHKPQMTPEVISVSDQQLLLGPDPSVR
QKQRLTRHLLQKADSGIHSSRDDRLILKEAKVWIEQFERDLTRAQMTESNLQDKYQSFKH
FRVQYELKRKQVEHIIQPLQRDGKLTLDQALVKQCWERVSSRLFDWHIQLDKSLPAPLGT
IGAWLYRAEVALREEITIQQVHEETANTIQRKLEQHKDLLQNTDAHKRAFHEIYRTRSVN
GIPMPPDQLEDMAERFHFVSSTSELHLMKMEFLELKYRLLSLLVLAESKLKSWIIKYGRR
ESVELLLQSYISFIENSKFFEQYEVTYQVLKQTAEMYVKADGSVEEAENVMKFMNETTAQ
WRNLSVEVRSVRSMLEEVISNWDRYGDTVASLQAWLEDAEKMLSQSENAKKDFFRNLPHW
IQQHTAMNDAGNFLIETCDEIVSRDLKQQLLLLNGRWRELFMEVKQYARADEMDRMKKEY
TDGTAALSGFAAEAHRKLSEPLEVSFMNVKLLIQDLEDTEKRVPVMDAQYKMIAKKAHLI
AKESPKEEANEMLTTMSRLKEQLSKVKECYSPLLYEAQQLSVPLEELETQITSFYDSLGK
INEILAVLEHEAQSSALFKQKHQELLACQESCKKSLTFIEKGSQSVQKLVTSSQALKHWD
HTKLQKQIADVHHAFQNMIKKTGDWKKHVEANSRLMKKFEESRAELEKVLRAAQEGLEEK
GDPEELLRKHTDFFSQLDQRVLNAFLKACDELTDILPEQEQQGLQEAVRKLHKQWKDLQG
EAPYHLLHLKIAVEKDRFSAAVEECRAELERETKLASQEGSEKIIKEHRVFFSDKGPHHL
CEKRLRLIEELCVKLPVRDPVRDTSGACHTALKELKASIDNTYMMLMDDPDKWTDYASRF
SELSSWVSAKESWLKNIKDQPIDTGNHDEVKRVADEMRNDITKKGEILSWLKSRLKHLID
VSSENEAQKRGDELAELSSSFKALVALLSEVEKMLSNFGECVQYKEIVKSSLEGLMSGSE
ESKDEAETILDTENLFEAQQMLLRHQQKTKMISAKKRDLQQQMEQGQQGGQAGPGQEELR
KLESTLTGLEQSRERQERRIQVSLRKWERFETNKETVVRYLFQTGSSHERFLSFSSLESL
SSELEQTKEFSKRTESIATQAENLVKEAAEMPLGPRNKRLLQQQAKSIKEQVKTLEDTLE
EDIKTMEMVKTKWDHFGSNFETLSNWITEKENELSSLETSASAMEMQINQIKVTIQEIEG
KIESVVGLEEAAQSFAQFITTGESARIKAKLTQIRRYWEELQEHARGLEGVILGQLSQQQ
KFEENLRKIQQSVSEFAERLAEPIKICSSAAETYKVLQEHMDLCQALESLSSTVTAFSAS
AQKVVNRESSTQETAALQQQYEEILHKAKERQKALEDLLAHWQRLEKGLSPFLTWLERCE
AIARSPEKDIAADRVKVDSELQLIQALQNEVVSQASLYSNLLQLKEALFSAASKEDVAMM
KLQLEQLDERWGDLPQIISKRMLFLQSVLAEHRQFDELLFSFSVWIKQFLSELQMTSEIN
LRDHQVALTRHKDHATEIEKKRGEVKHLQGHLAQLRSLGRAEDLHPLQSKADDCFQLFEE
ASQVVERRKLALTQLAEFLQRHASVSTLLHQLRQTVEATKSMSKKQSDSLKKDLHDAIQD
VKTLESSAIGLDGTLTKAQCHLKSGSPEQRTSCRATTDQLSLEVERIQNLLGTKQSEADA
LLVLKEAFQEQREELLRSIEDIEERTDRERLKEPTRQALQHRLRVFNQLEDELNSHEHEL
CWLKDKAKQIAQKDVALAPEVDREINRLEATWDDTKRLIHENQGQCCGLIDLVREYQNLK
SAVCKVLEDASHVVEMRATIKDQEDLKWAFSKHETSRNEMNSKQKELDSFTSKGKHLLSE
LKKIHSGDFSLVKTDMESTLDKWLDVSERIDENMDRLRVSLSTWDDVLSSRDEIEGWSNS
SLPQLAENISDLNNSLRAEEFLKELESEVKNKALKLEELHSKINNLKELTKNPETPTELQ
FIEADLRQKLEHAKEITEEAKGTLKDFTAQSTQVERFVKDITAWLVNVEESLTRYAQTYT
CEGLKKVKDIRKELQSQQNNIISTQEVLNSLCRKHHSVELESRGRAMTGLIKKHEATSQL
CSQTQASIQDSLEKHFSGSMKEFQEWFLGAKAAARESSNLTGDSQVLEARLHDLQGVLDS
FSDGQSKLDAVTQEGQTLYAHLPKQIVSSIQEQITKANEEFQAFLKQCLKDKQALQDCVS
ELGSFEDQHRKLNLWIHEMEERSNTENLGESRHHISEKKNEIHKVEMFLGELLAARESLD
KLSQRGQLLSEESHGAGKGGRRSTQLLANYQNLLRVTKERLRGCQLALQEHEALEEAMQS
MWSRVKDVKDRLACAESTLGDKETLEWRLSQIQDILLMKGEGEVKLNLAIGKGDQASKSS
NKEGQQAIQDQLETLKKAWADAMSSAVHAQSTLESVIDQWNDYLEKKSQLEQWMESVDQK
VEHPLQLQPGLKEKFSLLDHFQSIVSEAEDHTGALQQLAAKSRELYKKTQDESFKEAVQE
ELRTQFQDILTVAKEKMRTVEDLVKDHLMYFDAVQEFTDWLHSAKEELHRWSDTSGDSSA
TQKKLSKIKELMDSREIGAGRLSRVELLAPSVKQNTAASGCELLNSEMQALRADWRQWED
CLLQTQSSLENLVSEMALSEQEFSGQVARLEQALEQFSTLLKTWAQQLTLLEGKSTDEEI
VECWHKEREILDALQKAEPMTEDLKSQLNELCRFSRDLSPYSGKVSGLIKEYNCLCLQAS
KGCQSKEQILQERFQKASKSFQQWLVNAKITTAKCFDLPQNLSEVSSSLQKIQEFLSESE
TGQHKLNTMLSKGELLSSLLTKEKAQAVQAKVLTAKEDWKHFHANLHQKESALQNLKIQM
KDFEVSAEPVQNWLSKTKRLVQESSIRLYDLPAKRREQQKLQSVLEEIQCYEPQLHRLKE
KARQLWEGQAASKSFVHRVSQLSSQYLALSNVTKEKVSRLDRIVAEHNQFSLGVKELQDW
MSDAVHMLDSYCLPTSDKSVLDGRMLKLEALLSVRQEKEIQIKMIMTRGEYVLQSTSPEG
SHAVQQQLQALKEKWESLLSAAIRCKSQLEGALSKWTSYQDDVRQFSSWMDVVEVSLTEL
ERQHTELREKVTTLGKAKLLNEEVLSHGSLLETIQVKRAAMTEHYVTQLELQDLQERHQV
LKEKAKETVTKLEKLVRLHQEYQRDLKAFENWLGQEQEKLDRSSVLEGDTNAHETTLRDL
QELQVRCAEGQALLNSVLHTREDVILSGLPQAEDRVLESLRQDWQVYQHRLAETRMQFNN
VANKLRLMEQKFQEADEWLQRMEEKISVRNERQSSRSAKEIQLLQLKKWHEDLSAHRDEV
EEVGSRAQEILDESRVSSRMGCQATQLTSRYQALLLQVLEQIKFLEEEIQCLEETESSLS
SYSDWYGSTHKNFKNVATKIDKVDEAMMGKKLKTLEVLLKDMEKGHSLLKSAREKGERAV
KFLEGSEAEALRKEIHAHMEQLKNLTSAVRKEHVSLEKGVHLAKEFSEKYKVLTRWLAEY
QEILLTPEEPKMELYEKKAQLSKYKSLQQMVLSHEPSMNSVQEKSEALLELVQDQTLKDK
IQKLQSDFQDLCSIGKERVFSLEAKVRDHEDYNTELQEVEKWLLQMSGRLAAPDLLETSS
LETITQQLAHHKAMMEEIAGFEDRLDNLKAKGDTLIGQCPDHLQAKQKQSVQAHLQGTKD
SYSAICSTAQRVYRSLEYELQKHVSRQDTLQQCQAWISAVQPDLKPSPQPPLSRAEAVKQ
VKHFRALQEQARTYLDLLCSMCDLSNSSVKNTAKDIQQTEQLIEQRLVQAQNLTQGWEEI
KNLKAELWIYLQDADQQLQNMKRRHAELEINIAQNMVLQVKDFIKQLQCKQASVSTITEK
VDKLTKNQESPEHKEISHLNDQWQDLCLQSDKLCAQREQDLQRTSSYHDHMSIVEAFLEK
FTTEWDNLARSNAESTAVHLEALKKLALALQEKKFAIDDLKDHKQKLMEQLSLDDRELLR
EQTSHLEQRWFQLEDLVKRKIQVSVTNLEELNVVQSRFQELTEWAEEQQPNIVEALKQSP
PPGTAHHLLTDHLAICSELEAKQVLLKSLMKDADRVMADLGLNERKVIQKVLSEAQKHVS
CLNDLVGQRRKYLNKALSEKTQFLMAVFQATSQIQQHERKIMFREYVCLLPDDVSKQVKT
CKTAQASLKTYQNEVTGLWTQGRELMKGITEQERNEVLGKLQELQSVYDTILQKCSHRLQ
ELEKSLVSRKHFKEDFDKAQHWLKQADIVTFPEINLMNERVELHAQLDKYQSILEQSPEY
ENLLLTLQTTGQAMLPSLNEVDHSYLSEKLSAMPQQFNVIVALAKDKFYKIQEAILARKE
YASLIELTTQSLGDLEDQFLKMRKMPSDLIVEESVSLQESCRTLLGEVVALGEAVNELNQ
KKESFRSTGQPWQPEKMLQLATLYHRLKRQAEQRISLLEDTTSAYREHAQMCQQLESQLE
VVKREKAKVNEETLPAEEKLKVYHSLAGSLQDSEILLKRVAVHLEDLSPHLDPMAYEKGK
GQVQTWQEELKQMMSEIGEMVTECESRMVQSIDFQTEMSRSLDWLRRVKAELSGPVCLDL
RLQDIQEEIRKIQIHQEEILSSLRIMSALSQKEQEKFTKAKELISADLEHTLAELKELDG
DVQEALRTRQVCRGCSIFFQAVHLVWCQRYYQVCQEANDWLEDAQEMLQLVGNGLDVESA
EENLKSHMEFFKTEGQFHSHMEELRGLVARLDPLIKPTGKEELAQKMASLEKRSQGVIQD
SHTQRDLLQRCSVQWQEYQEAREGVIKLMNDVEKKLSEFVVTKISSSHEAEEKLSEHRAL
VSVVDSFHEKIVALEEKASQLEQTGNEANKATLSRSMTTVWQRGTRLRAVVQDQEMILED
AVDEWKALSAKIKENTEIINQLQGRLPGTSTEKTSKAELIALLESHDTFAMDLERQQLAL
GVLQQRALSMLQDGALPGPKEEVPTLQEITALQDQCLNMQEKVKNHGKLLKQELQEREAV
ETCINSVKSWVQETKDYLGNPTLEVDTQVEELKSLLAEATSHRESIEKIAEEQKNKYLGL
YTILPSEISLQLAEVALDLKIHDQIQEKVQEIEQGKAMSQEFSCQIQKVAKDLTTILTKL
KAKTDNLVQAKADQKMLGEELDSCNSKLMELDTAVQTFSEQHGQLGKPLAKKIGKLTELY
QQTIRQAENRLSKLNQASSHLEEYSEMLESIQKWIEKAKVLVQGNIAWNSASQLREQYIL
HQTLLEESEEIDSDLETMAEKVQYLANVYCTGKLSQQVTQLGRETEELRQAIRVRLQSLQ
DAAKDMKKFEGELRNLQVALEQAQTILTSPEVGRLSLKEQLSHRQHLLSEMESLKPKVQA
VQLCQSALRIPEDVVTGLPLCHAALRLQEEASQLQHTAIQQYNIMQAGATAQRVQPAGPT
LEAVVQYEQYGQEMKHLQQLIEAAHREIEDKPVATGNIQELQAQISRHEELAQKIKGYQE
QIASLNSKCKMLTMKAKHATMLLTVTEVEGLAEGTEDVDPELLPTPSAHPSVVMMTAGRC
HTLLSPVTEESGEEGTNSEISSPPACRSPSPVANTEASVNQVPPPTPPSHTVSSWWMQYS
VAILIGLWLGVPNFIEFGSRGHIIKCDSHDIAYYQALSAEGLQTDAARIAPSAAASQELY
EPGLEPSATAKLGDLQRSWETLKNVISEKQRTLYEALERQQKYQDSLQSVSTKMEAMEMK
LSESLQPGRSPESQMAEHQALMDEVQMLQDEINGLQASLAEELVAESQESDPAEQLALQS
TLTVLAERMSTIRMKAAGKRQLLEEKLNDQLEEQRQEQALQRYRCEAEELDHWLLNTKAT
LDFAAGIPQEPMDMDAQLVDCQNMLVEIEQKVVALSQLSVRSENLLLEGKAHTKDEAEQL
ASKLRMLKGSLMELQRALRDRQLNMQGVTQEKEENDVDFTATQSPGVQEWLAQARNTRTH
QRQSSLQQQKIENSDSDNDHQRLSEVTPVFVFVQEFEQELAEQKSLLRSVASRGEEILIQ
HSTAEGSGGLGEKPDALSQELVMEGAKSFAEDQMRAKWESLHQEFSTKQKLLQNILEQEQ
EQMLYSSPNRLLSGVLPLRGEAQTQDKSSVTSLLDGLSQAFGEVSSQSGGTDRQNIHLEQ
KLYDGVSATSTWLDDVEEHLFVATALLPEETETCLFNQEALAKDIKEMSEEMDKNKNLFS
QAFPEDSDNRDVIEDTLGCLLGRLSLLDSVVGQRCHQMKERLQQVLSFQNDLKVLFTSLA
DNNYIILQKLANMFKQPIVEQIQAIQQAEEGLRELDGGISELKQRGDKLQVDQSALQELS
KLQDMYDELLVTISSRRSNLNQNLALKSQYDKALQDLVDLLDTGQEKMAGDQKIIVSSKE
EVQQLLSKHKMKGFVVETCVYSTVKSHLYLSGVKREGQLGAQSLDFAGMPCRKHTLLVKM
VVQQCEEYFQGLESHLILTETLFRKIVDFAAMKETQLHSDRMAQASAVLKQAHKRGVELE
YILEMWSHLDENLQELSRQLEVIENSIPSVGLVEESEDRLVERTSLYQHLKSSLNEYQPK
LYQVLDDGKRLMMSISCSELESQLNQLGERWLGNTNKVSKELHRLETILKHWTRYQSEAA
DLIHWLESAKDKLAFWTQQSVTVPQELEMVRDHLNAFLEFSKEVDAKSSLKSSVTSTGNQ
LLRLKKVDTAALRAELSCMDSQWTDLLAGIPAVQEKLHQLQMDKLPSRHAISEVMSWISL
MESVILKDEEDIRNAIGYKAIYEYLQKYKGFKIDLNCKQLTADFVNQSVLQISSQDVESK
RSDKTDFAEQLGAMNKSWQLLQGRVGEKIQMLEGLLESWSEYENSIQSLKAWFANQERKL
EEHHQIGDQNSVQNALKDCQELEDLIKAKEKEVEKIEQNGLALIQNKREEVSCSVLNTLW
ELRQTWASLERTVGQLKIQLTLVLGQWSIHKAAFEEISNHLMEARYSLSRFRLLTGSSDA
VQVQVDNLQNLHDDLEKQEGDLQKFGSLTNHLLKECHPPVAEALSSTLQEVNMRWNNLLE
EIAKQLHSSKALLQLWQRYKDYSKQCASAVQRQEEQTNALLKAATSKDIADDEVAKWIQD
CNDLLKGLGTVKDSLFILHELGEQLGQQVDDSAATTIQCEQLCFSQRLEALEQALCKQQA
VLQAGVVDYETFAKSLEALEAWIVEAEGILQAQDPTHSSDLSTIQERMEELKGQMLKFSS
MAPDLDRLNELGYRLPLNDKEIKRMQNLNRHWSLISSQTTERFSKLQSFLLQHQTFLEKC
ETWMEFLVQTEHKLAVEISGNYQHLLEQQRAHELFQAEMFSRQQILHSIIVDGQNLLEQG
QVDDREEFSLKLTLLSNQWQGVIRRAQQRRGIIDSQIRQWQRYREMAEKLRKWLVEVSHL
PLSGLGSIPVPLQQVRTLFDEVQFKEKVFLRQQGSYILTVEAGKQLLLSADSGAEAALQA
ELTDIQEKWKSASTHLEEQKKKLAFLLKDWEKCEKGIADSLEKLRTFKKRLSQPLPDHHE
ELHAEQMRCKELENAAGRWTDDLAELVLLREALAAHLSAEDISILKERVELLQRQWEELC
HQVSLRRQQVSERLNEWAVFSEKNKELCEWLTQMESKVSKNGDIFL
Download sequence
Identical sequences 10116.ENSRNOP00000050794 ENSRNOP00000025795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]