SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000051020 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000051020
Domain Number 1 Region: 63-121
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 8.51e-17
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000051020
Sequence length 145
Comment (Rattus norvegicus)
Sequence
MEKCKSAGLLALHSPLRASPLGALARREPCRVSARQDTADCARRRPCPSLPPGGVAEPAF
LRQRNERERQRVRCVNEGYARLRQHLPRELAGQRLSKVETLRAAIGYIKQLQELLERHRP
DLNSDGESKASSGASPCSSEPEERG
Download sequence
Identical sequences D3ZS54
ENSRNOP00000051020 ENSRNOP00000051020 XP_006226038.1.4139 XP_006241232.1.100692 10116.ENSRNOP00000051020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]