SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000052551 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000052551
Domain Number 1 Region: 50-149
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000192
Family PDI-like 0.0035
Further Details:      
 
Domain Number 2 Region: 139-255
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000215
Family PDI-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000052551
Sequence length 272
Comment (Rattus norvegicus)
Sequence
MKITWSRCLILSLVLSCRLVPEATADVEETSEGLGTPREPRWLTDIPATVELIAAAEVAV
IGFFQDLEIPIVSIFRSMAQQFQDVSFGISNHSEVLTHYNVTSNSICLFRLVDNKQLRLD
AEDIDDLDAAKLSRFIHLNNLHWVTEYSPMIGAGLFNTMVQTHLLLIMNKASPEYEESLR
SYQKAAKLFQGQILFVLVDSGKRENGKVIAYFRLKESQLPALAIYESVDDKWDALTITEV
TVEKVQSFCNGFLKGMLLRDQKAENDSGKEEL
Download sequence
Identical sequences D4A9L9
ENSRNOP00000052551 10116.ENSRNOP00000052551 ENSRNOP00000052551 NP_001100095.1.100692 NP_001100095.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]