SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000054564 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000054564
Domain Number 1 Region: 5-108
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000125
Family MAM domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000054564
Sequence length 115
Comment (Rattus norvegicus)
Sequence
WTVDCGLTQDPEDDLDWSIGSVITTEALSPDSDHTPGSGRHFLFVNSSLSREGSTARVIT
SRFFPASLGMCTVRFWFYMVDPQIMGILKTVYTIHEGNFLIILLWSSYSVKELGR
Download sequence
Identical sequences 10116.ENSRNOP00000054564 ENSRNOP00000054564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]