SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000055466 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000055466
Domain Number 1 Region: 278-348
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.07e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000792
Further Details:      
 
Domain Number 2 Region: 20-87
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000104
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000415
Further Details:      
 
Domain Number 3 Region: 102-174
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000778
Family Eukaryotic type KH-domain (KH-domain type I) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000055466
Sequence length 358
Comment (Rattus norvegicus)
Sequence
PSPSXLPRXLLDMDTGVTEGGLNVTLTIRLLMQGKEVGSIIGKKGESVKKREESGAHLNI
SEGNCPERIITLAGPTNATFKAFAMIKLEEDRSRSMTNSTAASRPVTSRLVVPDSQCGSL
IGKGICKIKEVGETTGPVQVAGDMLPNSSEQAIPIASIPQSIIECVNQIGVVMLETQHSP
KGVTIPYLPKPSSSIVIFAGGQDRYSIGSNSVSFPHTILSMYLNPDLERPPLEAYTIQGQ
YAIPQPDLTKLHQLAMQQFHFPMTCGNTGFGIEAGSDASAQTTSHELTPNDLIGCIIGRQ
GAKINEIHQMSGAQIKIANPEGSTDRQVTITGPAASISLAQYLINVRLSPETGGTGSS
Download sequence
Identical sequences ENSRNOP00000055466 10116.ENSRNOP00000055466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]