SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000055547 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000055547
Domain Number 1 Region: 23-144,178-285
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.97e-77
Family Calponin-homology domain, CH-domain 0.0000411
Further Details:      
 
Domain Number 2 Region: 339-458
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000835
Family Spectrin repeat 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000055547
Sequence length 528
Comment (Rattus norvegicus)
Sequence
MADSPVPPTEDGQGFLGIDDLHFSLQAEQEDTQKKTFTCWINSQLAKHAPPSVISDLFTD
IKKGHVLLDLLEVLSGQQLPRDKGSNTFQCRINIEHALTFLKNRSIKLINIHVADIIEGN
PSIILGLIWTIILHFHIEKLAQALSCDYNQPSPEVVSVADSSPTSSPPAKKCSKAQAQAR
WQWSAKKALLQWAQEQCAGLGSVSVTDFKSSWRNGLAFLAVIHSLRPDLIDMDSVRHRSN
QDNLKEAFRIAEHELKIPKLLEPEDVDVVNPDEKSIMTYVAQFLKYSKDAPGPGGSSQAK
VKDAVVWLTLQEKRLQQMLKDSESETYCNNYHSLLSFMESLNEEQKSFTDVLSPRERMEE
WSEDELQLRQGWTSLTQQVAEWKAQLDDALPSPLKEMEAWLKAVEGLVEEGVPTSQNYSE
ARTLIQGKISLFKSLMDSFDYHSNILLSFENRAEKNLPLVPPAKLEEMTRRINNVLGKNF
ISLLEFHDSKCSVLALLDEAKAKLDVWNGAYGSKESVVVLLEDWHKFT
Download sequence
Identical sequences 10116.ENSRNOP00000055547 ENSRNOP00000007046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]