SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000056457 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000056457
Domain Number 1 Region: 90-221
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000301
Family YWTD domain 0.0026
Further Details:      
 
Domain Number 2 Region: 40-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000265
Family EGF-type module 0.0086
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000056457
Domain Number - Region: 9-50
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000218
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000056457
Sequence length 223
Comment (Rattus norvegicus)
Sequence
LLPSCQQLNCQFKCAMVRNATRCYCEDGFEVTGDGRGCKDQDECSVYGTCSQTCKNTYGS
YVCSCVEGYIMQSDNRSCKVKNEPSDKPPMLLIASPETIELFYINGSKMTTLSSANRNEI
HTLDFIYSEEMICWIESRESSNQLKCGQMTKSGRLIDQRIINSLQSFHNVEQMAIDWLTR
NIYFVDHVSDRIFVCNFNGSVCVTLIELELHNPKAIAADPIAG
Download sequence
Identical sequences ENSRNOP00000056457 10116.ENSRNOP00000056457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]