SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000056753 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000056753
Domain Number 1 Region: 108-168
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.00000000000000719
Family EB1 dimerisation domain-like 0.0000834
Further Details:      
 
Domain Number 2 Region: 2-46
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000523
Family Calponin-homology domain, CH-domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000056753
Sequence length 182
Comment (Rattus norvegicus)
Sequence
LGAEKVCNVAQLMKRKFQDNFELVQWFKMFSDANYNGKEHDPVAARQGQETVVAPVAPAL
SKPKKPLSSGSAAPQRPMATQRTTAASKAGPGMVRRNPGVGNGDDEAAEWKQQVKVLTLT
VEDLEKERGFYFGKLRNIELISQESEGENDPGLQRTVDSLYATDEGFVIPDEGSPQAEQE
GC
Download sequence
Identical sequences 10116.ENSRNOP00000056753 ENSRNOP00000056753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]